Доказательства эволюции (fb2)


Использовать online-читалку "Книгочей 0.2" (Не работает в Internet Explorer)


Настройки текста:


Н.М.Борисов, Ф.Ю.Воробьев, А.М.Гиляров, К.Ю.Еськов, А.Ю.Журавлев, А.В.Марков, А.А.Оскольский, П.Н.Петров, А.Б.Шипунов ДОКАЗАТЕЛЬСТВА ЭВОЛЮЦИИ Под редакцией А.В.Маркова

Часть I. Вводная часть

Вступительное слово

Современная биология неотделима от концепции биологической эволюции. Как сказал один из крупнейших биологов-теоретиков XX века Феодосий Григорьевич Добржанский (1900–1975), «ничто в биологии не имеет смысла кроме как в свете эволюции» (nothing in biology makes sense except in the light of evolution) — так было озаглавлено его эссе, опубликованное в 1973 г.

Мировое научное сообщество обоснованно считает, что имеющиеся доказательства эволюции настолько неопровержимы и всеобъемлющи, что отрицать факт биологической эволюции, оставаясь в рамках науки, сегодня уже невозможно. К каждому отдельному примеру или аргументу всегда можно при большом желании придраться (этим и занимаются антиэволюционисты, часто не совсем точно именуемые креационистами — люди, отвергающие научную концепцию эволюции), но с научными представлениями об эволюции согласуются миллионы фактов. Эволюция придает смысл, логику и стройность всему гигантскому массиву накопленных биологией знаний.

Однако то, что очевидно специалистам, далеко не всегда очевидно людям, не занимающимся наукой профессионально. К сожалению, антиэволюционистская пропаганда продолжает находить отклик в сердцах многих далеких от биологии людей. Этому есть целый ряд причин, в том числе психологических. Например, многим кажется, что происхождение от обезьян умаляет человеческое достоинство. По мнению ряда психологов, живучесть креационизма отчасти связана с врожденными особенностями человеческой психики. В частности, людям, особенно в детстве, свойственна так называемая «неупорядоченная телеология» — склонность приписывать некую изначальную цель всем объектам окружающего мира (тучи существуют, чтобы шел дождик, а львы — чтобы смотреть на них в зоопарке) (см.: Неприятие научного знания уходит корнями в детскую психологию).

Помимо врожденных психологических особенностей, распространению креационизма и других ненаучных и лженаучных представлений и суеверий способствует и распространение демократических ценностей. Как это часто бывает, люди начинают применять законы и правила, справедливые и уместные в рамках определенного круга явлений, далеко за пределами области их применимости. Что хорошо для политики и социальных отношений, не обязательно хорошо для науки. В науке нельзя ни решать вопросы всеобщим голосованием, ни рассматривать любые точки зрения как изначально равноправные, ни считать одинаково весомыми мнения экспертов и дилетантов (подробнее см.: Письмо на Российское телевидение). Это особенно актуально для биологии.

Современная биология в значительной мере основана на фактах и идеях, которые противоречат врожденным склонностям нашей психики. Из всех наук именно биология, по мнению многих, вступает в самое сильное противоречие с религией. Не секрет, что у представителей многих конфессий факт происхождения человека от обезьян часто вызывает резкое неприятие.

Эволюция является твердо установленным научным фактом. Но для того, чтобы это осознать, необходимо довольно подробное знакомство с данными биологической науки. Между тем даже профессиональным биологам в наши дни трудно ориентироваться в неиссякаемом потоке новых фактов, опытов, открытий и гипотез. В связи с этим популяризация биологических знаний сегодня приобретает особенно большое значение. Мировое научное сообщество вполне это осознает, чему свидетельством большое количество научно-популярных книг об эволюции, изданных в последние годы (к сожалению, преимущественно за рубежом).

Электронная публикация «Доказательства эволюции» представляет собой популярное пособие для тех, кто интересуется естественными науками, но не занимается ими профессионально, в том числе для продвинутых школьников. В нем рассказано об основных группах научных фактов, подтверждающих реальность биологической эволюции, и о том, почему представления антиэволюционистов нельзя считать научными.

Популярная форма изложения неизбежно приводит к упрощению многих сложных понятий. Невозможно рассказать о сложных понятиях широкой аудитории, ничего не упрощая и не опуская никаких подробностей. Поэтому данная публикация, возможно, не годится на роль полноценного научного справочника, но полезна для первоначального ознакомления с обсуждаемыми предметами. К тому же все ключевые факты мы старались подкреплять либо прямыми ссылками на научные публикации, либо (чаще) на научно-популярные статьи, в которых, в свою очередь, непременно имеются ссылки на научные первоисточники. Таким образом, официальные научные подтверждения изложенных здесь сведений в большинстве случаев находятся либо в одном, либо в двух «кликах» от нашего текста.

Одна из проблем, связанных с популяризацией научных представлений об эволюции, состоит в том, что ученых убеждать не надо, а антиэволюционистов сложно переубедить (они, в силу своих взглядов, относятся с недоверием к науке и к аргументам, которые можно выдвинуть в русле научного подхода). Но, по крайней мере, тем, у кого еще нет сложившихся убеждений по вопросам, связанным с эволюцией, и тем, кто сомневается в справедливости утверждений антиэволюционистов, можно и нужно напоминать о том, что научное сообщество целиком и полностью разделяет взгляды эволюционистов, а не креационистов, и объяснять, какого рода данные и аргументы привели к признанию факта эволюции современной наукой.

Антиэволюционисты нередко ссылаются на высказывания авторитетных ученых, якобы подтверждающие их взгляды. Нельзя сказать, чтобы ни один крупный ученый никогда не высказывался в поддержку тех или иных идей, свойственных антиэволюционистам. Но все же в наши дни в мире нет грамотных биологов, геологов и астрофизиков, которые отрицали бы миллиарды лет существования Земли и жизни на ней. Что же касается механизмов, лежащих в основе эволюции, то у некоторых ученых есть сомнения относительно того, все ли принципиальные механизмы эволюции уже известны науке. Но почти никто из специалистов не сомневается в том, что известные на сегодня механизмы существуют и играют в эволюции важную роль, а еще неизвестные принципиально познаваемы и могут быть рано или поздно открыты наукой. В частности, ни у одного грамотного биолога не вызывает сомнений реальность естественного отбора и его важная роль в эволюции.

Антиэволюционисты могут похвастаться лишь несколькими именами известных ученых, разделяющих их взгляды, и то известность этих ученых связана преимущественно с их пропагандой антиэволюционизма, а не с научными достижениями, обычно довольно скромными. Антиэволюционисты нередко пытаются убедить общественность в том, что в современной науке есть принципиальные разногласия относительно биологической эволюции. Некоторые разногласия в этой области, действительно, есть, но они касаются отдельных деталей эволюционного процесса и среди них нет ни одного принципиального. В пределах антиэволюционизма разногласий намного больше, и многие из этих разногласий принципиальны (например, в вопросе о том, соответствует ли история Земли слово в слово тому, что записано в Библии, или все же библейский текст о сотворении мира следует понимать как аллегорию — как считают и многие верующие эволюционисты).

Авторы данной публикации призывают к примирению религиозных людей с наукой. Среди ученых, в том числе эволюционистов, есть как атеисты и агностики, так и глубоко верующие люди. Все эти три категории представлены и среди авторов настоящей публикации (трое из которых являются православными христианами). Многие верующие, в том числе богословы, принимают выводы эволюционной биологии и не считают их противоречащими своей вере.

Примечательно, что многое в священных текстах никто, даже самые ортодоксальные богословы, не предлагает понимать буквально (например, притчи), а многое понять буквально просто невозможно — из-за отличающегося во многих конкретных деталях изложения одних и тех же событий, например, в разных книгах Библии, или в разных главах книги Бытия. Казалось бы, почему бы верующим не отказаться и от буквального понимания священных текстов об истории сотворения мира, жизни и человека? Следует признать, что такой отказ сопряжен с трудностями богословского свойства. Научные данные непросто соотнести, например, с представлением о Грехопадении как о первоисточнике зла. Получается, что богословы вынуждены или идти на поводу у науки и пытаться найти новые ответы на старые вопросы (а любая религия по своей природе консервативна и не склонна к поиску новых ответов), или отвергать научные данные, объявляя их плодами обмана или заблуждений.

Но идти против выводов науки в современном мире, где научные достижения и связанные с ними технологии проникают во все без исключения сферы жизни, довольно сложно. Ничего нельзя с этим поделать: нужно доверять науке. История знает немало примеров того, как религиозные представления видоизменялись с учетом научных данных. Когда-то считалось, что рай находится на облаках, а ад — глубоко под Землей. Теперь, благодаря научным открытиям, уже мало кто так считает. И богословы не пытаются доказать, будто наука здесь ошибается. Представление о вращении Земли вокруг Солнца когда-то казалось многим людям чудовищным богохульством, к тому же противоречащим библейскому свидетельству о том, что Солнце было сотворено позже Земли, и что оно, по крайней мере однажды, останавливалось на небе. Теперь уже мало кто продолжает настаивать на вращении Солнца и планет вокруг Земли. Богословы перестали считать научное представление о вращении Земли вокруг Солнца противоречащим религии. Верующего человека такие примеры того, как религия идет на поводу у науки, могут огорчать, но могут и радовать, если он — не без оснований! — считает, что научные открытия делаются с помощью разума, неспроста дарованного человеку Богом.

В России большинство антиэволюционистов — православные христиане. При этом Русская Православная Церковь в настоящее время не имеет официальной позиции по вопросу об эволюции. Среди православных христиан, в том числе священнослужителей, есть не только креационисты, но и немало эволюционистов (см., например: о. Андрей Кураев «Может ли православный быть эволюционистом»; о. Роман Братчик «Дарвин — это голова!»). В свою очередь, среди ученых, внесших свой вклад в развитие эволюционной теории, были и есть православные христиане. В частности, православие исповедовал и упомянутый выше Ф. Г. Добржанский, один из крупнейших эволюционистов в истории науки.

Антиэволюционисты есть не только среди христиан, но и среди приверженцев ислама, буддизма, индуизма и других религий. Часто это очень разные варианты антиэволюционизма, ведь даже представление о едином Боге-создателе есть не во всех религиях. Священные тексты по-разному описывают историю сотворения или возникновения мира и человека. У всех разные мнения, но наука на всех одна. Это не должно обескураживать верующих людей, ведь это еще не говорит о том, что наука выше религии. Например, Интернет тоже для всех один, но люди самых разных убеждений смиряются с тем, что их взгляды представлены в том же Интернете, что и убеждения их оппонентов. В современном обществе все пользуются плодами научных открытий, и всем стоит знакомиться с достижениями науки. Как примирить научные данные с религиозными убеждениями — непростой вопрос, на который нет единственного устраивающего всех ответа. Но ответ на него должны искать богословы — и может искать для себя каждый верующий. Дело ученых и работников светской системы образования — способствовать тому, чтобы наука развивалась, а ее достижения становились всеобщим достоянием.

Очень может быть, что когда-нибудь споры креационистов с эволюционистами уйдут в прошлое, и попытки убедить людей в том, что Земле несколько тысяч лет, или что естественный отбор не может быть причиной эволюционных изменений, станут так же редки, как стали в наши дни попытки убедить людей в том, что Земля плоская, или что Солнце и планеты вращаются вокруг Земли. Но для того, чтобы эти споры остались в прошлом, нужно добиться намного лучшего знакомства всех и каждого с достижениями науки. Данная публикация представляет собой попытку сделать шаг в этом направлении, преодолев еще один маленький участок большого и трудного пути. Едва ли представленные в ней материалы переубедят тех, кто относится к науке с предубеждением. Переубедить их сложно, а иногда и невозможно. Но будем надеяться, что она убедит непредвзятых читателей и послужит для всех, кто возьмется за ее чтение, источником интересных и полезных сведений.

П.Н. Петров, канд. биол. наук

А.В. Марков, доктор биол. наук

А.А. Оскольский, канд. биол. наук

Н.М. Борисов, доктор техн. наук, канд. физ. — мат. наук

А.М. Гиляров, доктор биол. наук, профессор

К.Ю. Еськов, канд. биол. наук

А.Ю. Журавлев, доктор биол. наук

А.Б. Шипунов, канд. биол. наук

(текст основан на предисловии к русскому переводу книги «Происхождение жизни: наука и вера», изданной Американской академией наук и вышедшей на русском языке в 2009 г.)

1. Существуют ли среди ученых разногласия по поводу реальности биологической эволюции?

Самый большой успех, достигнутый противниками эволюции за годы активной пропагандистской деятельности, состоит в том, что им удалось внушить значительной части населения ложное представление о наличии разногласий в науке по поводу реальности эволюции. Устойчивость этого заблуждения базируется на непонимании того, что представляет собой современное мировое научное сообщество (мы говорим сейчас о естественных науках, которые соответствуют английскому слову science, а не о гуманитарных, в которых ситуация может быть иной). В отличие от религий, которых одновременно существует множество и которые принципиально не могут прийти к единому мнению по многим ключевым мировоззренческим вопросам, мировое научное сообщество де-факто является единым. Каждая новая гипотеза или теория проходит более или менее долгую экспериментальную проверку и в конце концов либо принимается сообществом, либо отвергается. Нет и не может (а главное, не должно) быть в современном мире таких естественнонаучных концепций, которые являются общепринятыми и почитаются за истину, например, в американской науке, но полностью отвергаются в германской, японской или индийской. Если подобная ситуация все же возникнет, ученые всего мира будут прилагать большие усилия, чтобы разрешить спор и установить истину. Если такое положение сохраняется надолго (как в случае с лысенковщиной в СССР), то это воспринимается как трагическая аномалия, как уход части ученых из мира науки в мир квази- или псевдонауки. Разумеется, есть разные научные школы и традиции, но в естественных науках в целом господствует твердое убеждение, что истина реально существует, ее в принципе можно установить научными методами, и именно к этому нужно всем стремиться. Отдельные разногласия, конечно, неизбежны (без них наука не может развиваться), но каждое отдельно взятое разногласие — это временное, преходящее явление. И если уж какой-то факт удается твердо доказать, то его принимает все научное сообщество, и разногласия между «школами» на этом заканчиваются. Эволюция — яркий пример такого факта. Теории, касающиеся механизмов и движущих сил эволюции, продолжают развиваться, и по некоторым из них сохраняются разногласия, но реальность самого факта эволюции в рамках мирового научного сообщества не оспаривается уже давно. В науке единство мнений по фундаментальным вопросам принципиально достижимо, потому что научные выводы основаны на объективных вещах — наблюдениях, расчетах и экспериментах, которые можно независимо повторить и проверить.

Поэтому когда мы говорим, что факт биологической эволюции признан мировым научным сообществом, за этими словами скрывается нечто гораздо большее, чем кажется многим далеким от науки людям.

Крайне важно понять, что мировое научное сообщество давно уже вышло из того возраста, когда его можно было долго «водить за нос». Масштаб мировой науки уже давно не тот. Научное сообщество стало для этого слишком огромным и разнообразным. По последним данным, только в США, Западной Европе и Китае сейчас работает около 4,5 миллионов профессиональных ученых; в России на сегодняшний день — около 400 тысяч. По-видимому, не менее 30–40 % из них (а возможно и больше) занимаются биологией или смежными науками (медицина, палеонтология и др.). Все эти миллионы ученых живут в странах с самыми разными идеологическими, политическими, религиозными и экономическими обстановками; у них весьма разные области интересов, отношение к религии и т. п. И тем не менее, если мы начнем просматривать один за другим издаваемые в этих странах научные журналы, нам будет крайне трудно — если вообще возможно — найти среди них такие, в которых публиковались бы статьи, отрицающие эволюцию. Читатели сами могут убедиться в масштабах происходящего (здесь очень важен именно масштаб), изучив содержимое самой представительной международной электронной био-медицинской библиотеки Pubmed. Например, поиск по фразе «evolutionary biology» выдает свыше 8500 статей, и хотя мы не просматривали их все, будьте уверены: среди них почти нет, а скорее всего совсем нет статей, отрицающих эволюцию. На слово «evolution» выпадает 260380 (четверть миллиона!) статей, и сколько ни просматривай их, найти хоть одну антиэволюционную не удается. На слово «creationism» находится только 105 статей, и это сплошь статьи, направленные против креационизма, или изучающие с естественно-научных позиций причины и механизмы распространения креационизма. Столь малое число работ по креационизму показывает, что научное сообщество просто-напросто не видит в креационизме серьезной темы для обсуждения. Где же тут признаки разногласий между учеными?

Мы категорически отрицаем возможность «мирового заговора» ученых, о котором нередко говорят противники эволюции. Такой заговор был бы невозможен чисто технически, даже если бы у каких-то научных коллективов и возникло желание (достойное всяческого осуждения) такой заговор организовать. Ученых слишком много, они живут в слишком разных странах, и среди них слишком высока доля честных людей, для которых главным «корыстным интересом» является поиск истины, а не отстаивание каких-то догм, идеологий или традиций. Если уж говорить о «корысти», то для любого нормального ученого обнаружить факт, опровергающий какую-либо устоявшуюся точку зрения — это кладезь, золотое дно, мечта всей жизни. Такая находка дает ученому шанс войти в историю. Эволюционное учение рухнуло бы давным-давно, если бы против него можно было собрать убедительный с научной точки зрения, то есть объективный и проверяемый «компромат» в виде фактов, наблюдений, результатов экспериментов и т. п.

Иногда российские антиэволюционисты пытаются связать эволюцию с коммунизмом, пользуясь тем обстоятельством, что дарвинизм действительно был частью идеологической системы в период правления коммунистов в России. Но эволюция признавалась большинством русских биологов и до 1917 года, и после краха социалистической системы российские биологи по-прежнему убеждены в реальности эволюции, не говоря о том, что в странах «капиталистического лагеря» приверженность эволюционным взглядам среди ученых все эти годы была уж никак не меньше, чем в СССР.

Иногда противники эволюции пытаются обосновать свое недоверие к биологическим данным ссылками на научные теории, которые когда-то считались общепринятыми, а после были отвергнуты. В качестве примеров приводятся теории теплорода и мирового эфира. Может быть, утверждают антиэволюционисты, и теория эволюции в будущем будет отвергнута и забыта наукой, подобно теплороду. Это рассуждение на первый взгляд может показаться убедительным, но в нем есть две ошибки. Во-первых, во времена теплорода и эфира мировое научное сообщество находилось на совершенно другой, гораздо более ранней стадии своего развития по сравнению с сегодняшним днем. Его численность была меньше на много порядков, а ведь этот показатель имеет самое прямое отношение к эффективности и «помехоустойчивости». Современная наука гораздо надежнее защищена от крупных ошибок, чем тогда. Кроме того, в те времена научное сообщество располагало на порядки меньшим объемом информации об устройстве мира. Это открывало простор для неточных моделей, потому что науке было известно гораздо меньше фактов, которым должна соответствовать новая теория. Нескольким сотням ученых, живущим в дюжине сходных по своему развитию и культуре стран и обладающим небольшим объемом знаний о мире, ошибиться неизмеримо проще, чем миллионам ученых, живущим в сотне разных стран и имеющим гигантский объем детальной информации о мире, недоступной их предшественникам. Во-вторых, теории теплорода и эфира не были полностью ошибочными. Возможно, точнее будет сказать, что «теплород» просто трансформировался из субстанции в «тепловую энергию». Эксперименты, которые успешно объяснялись теорией теплорода, никуда не делись. По-прежнему при помощи теплорода можно вычислить температуру смеси из 100 г воды с температурой 80 градусов и 200 г воды с температурой 20 градусов. Неплохо объясняются теплоемкость плавления/кипения/химической реакции и др. В конце концов «законы теплорода» влились в общие законы сохранения и преобразования энергии. Нечто аналогичное произошло и с «эфиром». Некоторые «свойства эфира» остались в виде «свойств электромагнитного поля», другие — нет. Точно так же химия элементов никуда не делась с открытием ядерных реакций. Нельзя сказать, что «химия вернулась к алхимии» оттого, что оказалось возможным превращение одного элемента в другой. Начиная с XVII века наука развивается в основном поступательно, не выбрасывая старых теорий в мусорную корзину, а присоединяя их к новым, как составные части, верные для определенных условий. Так же и с эволюцией: некоторые модели конкретных эволюционных механизмов могут быть в будущем пересмотрены, но сам факт биологической эволюции не будет отвергнут уже никогда. По крайней мере, не раньше, чем наука вернется к идее о плоской Земле на трех слонах.

И все же отдельные ученые действительно отвергают эволюцию, чаще всего по религиозным соображениям, думая, что их вера не согласуется с эволюцией (позиция, не разделяемая, как уже говорилось, очень многими верующими эволюционистами). Таким ученым, как правило, не удается опубликовать свои антиэволюционные идеи в солидных журналах (да они практически и не пытаются это сделать, понимая, что серьезных научных аргументов у них нет). Сколько их, таких ученых? Точной статистики, по-видимому, не существует, но на основе имеющихся данных можно с достаточной долей уверенности утверждать, что их менее одного процента среди всех ученых, а среди биологов, скорее всего, их намного менее одного процента. Креационисты, особенно американские, несколько раз пытались организовать сбор подписей среди ученых в поддержку креационизма, но, насколько нам известно, им так и не удалось собрать более 700 подписей лиц, которых можно с грехом пополам считать учеными (вряд ли следует удивляться, что большинство в этих списках составляют не биологи, а представители других наук). В ответ на это Национальный центр научного образования США организовал «Проект Стивов» (Project Steve). Ученые считают, что научные вопросы не решаются голосованием, поэтому серьезный сбор подписей «за эволюцию» организовывать не стали, а вместо этого сделали пародийный проект, в котором могут принимать участие только профессиональные ученые по имени Стив (Стивен); допускаются также ученые дамы по имени Стефани. На сегодняшний день подписалось уже свыше 110 °Cтивов и Стефани, причем доля биологов среди них гораздо выше, чем в креационистских списках. Известно, что эти имена носит около одного процента жителей США. Из этого следует, что число активных сторонников эволюции среди ученых США, по-видимому, более чем в сто раз превышает число активных антиэволюционистов. Общеизвестно, что США занимают первое место среди развитых стран по популярности креационизма. Следовательно, можно ожидать, что в других развитых странах антиэволюционистов среди ученых еще меньше. А главное, их антиэволюционные взгляды не считаются научными ни в одной стране, где есть хоть сколько-нибудь развитая наука. В том, что касается теоретической биологии, эти люди де-факто не считаются учеными, коллеги на них смотрят в лучшем случае как на чудаков.

От этих фактов нельзя отмахнуться. Удивительно, что некоторые люди, не являясь профессиональными биологами, тем не менее берут на себя смелость утверждать, что они лучше понимают основы биологии, чем мировое научное сообщество, включающее миллионы профессионалов из многих десятков стран. Даже если вы действительно считаете, что аргумент типа «ну не могла обезьяна взять и родить человека» опровергает эволюцию и каким-то образом остался вне поля зрения миллионов профессионалов, вы все-таки должны признать, что столь глубокая уверенность этих самых миллионов должна же на чем-то быть основана. Прежде, чем отвергать выводы науки, разберитесь сначала, почему наука пришла к таким выводам и почему так твердо придерживается их уже свыше 100 лет, невзирая на все различия между учеными разных стран в идеологии, вероисповедании, политических взглядах, национальной культуре и т. д. Факты, изложенные в этой публикации, оказались достаточно убедительными для профессиональных биологов всего мира. Если эти факты, однако, не являются убедительными для Вас — подумайте, может быть, все-таки это Вы чего-то не понимаете, а не миллионное сообщество профессионалов?

2. Чем гипотезы и теории отличаются от доказанных фактов

Сначала давайте уточним, что такое «доказательство». Только в математике можно доказать что-либо (например, теорему) абсолютно строго. Такие математически строгие и неопровержимые доказательства по-английски называются «proof». Биология — естественная наука, и поэтому в ней используются доказательства другого типа, которые соответствуют английскому слову «evidence» — «свидетельство в пользу». Мы собираем факты, потом выдвигаем гипотезу для их объяснения. Из этой гипотезы выводятся проверяемые следствия. После этого начинается самое главное — поиск новых фактов, которые позволяют эти предсказанные следствия проверить (либо подтвердить, либо опровергнуть). Полученные результаты позволяют оценить степень достоверности гипотезы. Чем больше подобных проверок выдержала гипотеза, тем ниже вероятность ее ошибочности. Разумеется, в ходе проверок в исходную гипотезу могут вноситься дополнения и уточнения. Постепенно, по мере накопления доказательств, вероятность ошибочности гипотезы снижается настолько, что ее перестают называть гипотезой и начинают называть теорией. Между гипотезой и теорией нет четкой грани: это постепенный переход. Если в дальнейшем суммарная «убедительность» собранных доказательств теории (свидетельств в ее пользу) вырастает настолько, что у компетентных ученых просто не остается причин сомневаться в ее справедливости, естественно-научную теорию начинают рассматривать как доказанную истину (доказанный факт).

Не только биология, но и другие естественные науки основаны преимущественно как раз на таких фактах, которые когда-то были просто гипотезами, потом стали теориями, а потом были признаны доказанными фактами. Например, биологическая эволюция до выхода в свет книги Дарвина «Происхождение видов» (1859) была скорее гипотезой, чем теорией. Дарвин сделал из нее хорошо обоснованную теорию. Кстати, всем, кто сомневается в реальности биологической эволюции, нужно обязательно прочесть эту книгу (русский перевод здесь). Если уж вы хотите возражать против научной теории, ознакомьтесь сначала с основными, самыми очевидными свидетельствами в ее пользу, которые были доступны еще в XIX веке.

Совершенно несостоятельны возражения против естественнонаучных гипотез и теорий, строящиеся по принципу «этого никто никогда не видел, следовательно, это не доказано». Очень многие научные истины (доказанные факты) недоступны непосредственному наблюдению. Например, никто никогда не видел ядро атома кислорода и не мог подсчитать в нем протоны, чтобы убедиться, что их там именно восемь, а не семь или тринадцать с половиной. Однако в ядре атома кислорода действительно ровно восемь протонов. Из этого обстоятельства вытекает много проверяемых следствий, все они подтверждены результатами экспериментов, поэтому ученые обоснованно считают наличие восьми протонов в ядре атома кислорода не гипотезой, не теорией, а доказанным фактом. Сомневаться в этом глупо и, главное, непрактично: если вы начнете планировать эксперименты или какие-нибудь технологические процессы, исходя из предположения об ином числе протонов в атоме кислорода, вас ждут большие разочарования. Биологическая эволюция является доказанным фактом в точно таком же смысле.

Со времен Дарвина ученые нашли много новых свидетельств в пользу биологической эволюции. Примерно начиная с 30-х годов XX века, когда развитие генетики позволило ответить на важнейшие вопросы, оставленные Дарвином без ответа, мировое научное сообщество стало считать эволюцию доказанным фактом (конечно, такая периодизация не является общепризнанной — но мы думаем, что многие биологи с ней согласятся). Однако из-за многозначности слова «теория» сохранилось в науке и такое понятие, как «теория эволюции». Это вовсе не значит, что эволюция — «всего лишь теория». То, что биологическая эволюция реально происходила и происходит на нашей планете — это факт, но для объяснения этого факта, для объяснения путей и механизмов эволюции, для понимания деталей этого процесса существует — и постоянно развивается и совершенствуется — большая и сложная совокупность научных представлений (сюда входят и гипотезы, и теории, и факты), которую называют «теорией эволюции» или «эволюционной теорией». Называть современную теорию эволюции «дарвинизмом» или «теорией Дарвина» — это плохая идея, потому что биологическая наука уже очень далеко продвинулась в понимании эволюции по сравнению с исходной теорией Дарвина (см.: А.Куприянов, 2009. «Дарвин: пора прощаться»). Сегодня только противники эволюции (антиэволюционисты) сознательно называют эволюционную теорию «теорией Дарвина» (а журналисты часто делают это по невежеству). Это обычный риторический прием, при помощи которого антиэволюционисты пытаются принизить эволюционную теорию, сведя ее к идеям одного-единственного ученого. Не будем ловиться на такие дешевые трюки.

Любая научная гипотеза обязана иметь проверяемые следствия. Если из гипотезы нельзя вывести никаких проверяемых следствий, то это гипотеза просто-напросто не является научной (по определению). С точки зрения науки и здравого смысла, это даже не гипотеза, а пустая болтовня, произвольная фантазия. Хороший пример такой «гипотезы» — знаменитый чайник Бертрана Рассела. Из эволюции вытекает огромное количество проверяемых следствий, проверка которых и стала главным источником доказательств эволюции. Противостоящая эволюции точка зрения — антиэволюционизм — позволяет вывести какие-либо проверяемые следствия только в том случае, если ее хоть как-то конкретизировать. Например, если кто-то утверждает, что все современные животные являются потомками особей, спасшихся от Всемирного потопа в Ноевом ковчеге (согласно библейскому преданию), то из этого, несомненно, вытекает ряд проверяемых следствий. Согласно этой идее, центром расселения современной фауны были окрестности горы Арарат. Следовательно, мы должны ожидать, что чем дальше от Арарата, тем меньше должно быть разнообразие животных, особенно тех, кто медленно и с трудом передвигается. Животные, не умеющие пересекать широкие морские проливы, должны встречаться только в Евразии, Африке и, может быть, на близлежащих островах. Уединенные, изолированные острова и материки (например, Австралия), должны иметь крайне бедную фауну, состоящую преимущественно из очень подвижных животных, умеющих хорошо летать или плавать. Вряд ли нужно объяснять, что проверяемые следствия «гипотезы Ноева ковчега» — а значит и сама гипотеза — решительно не выдерживают проверки фактами. Эта гипотеза никоим образом не предсказывает (и не объясняет) существование, например, разнообразной фауны лемуров на Мадагаскаре или кенгуру — в Австралии и Новой Гвинее, притом что нигде больше в мире эти животные не встречаются. Все лемуры — около сотни ныне живущих видов! — должны были, согласно этой гипотезе, дружно маршировать с горы Арарат прямо на Мадагаскар, нигде не останавливаясь надолго (чтобы не оставить ни одной ископаемой косточки), нигде не потеряв ни одного «отставшего» вида. Они должны были каким-то неведомым образом благополучно пересечь Мозамбикский пролив (наименьшая ширина — 422 км) и поселиться на Мадагаскаре. Причем ни одна из обезьян, живущих в Африке и Азии, почему-то не пожелала переселиться на Мадагаскар вместе с лемурами. Чем больше для принятия гипотезы нужно сделать подобных маловероятных допущений, и чем меньше известных фактов она в состоянии объяснить (причем объяснить лучше, чем другие, конкурирующие идеи), тем ниже достоверность гипотезы. В случае с гипотезой «Ноева ковчега» научная достоверность практически равна нулю, потому что нет буквально ни одного факта, который объяснялся бы этой гипотезой лучше, чем эволюционной теорией. Именно поэтому антиэволюционисты так не любят конкретизировать свои взгляды. Как только они их хоть немного конкретизируют, появляется возможность научной проверки, а этого антиэволюционизм систематически не выдерживает.

Что касается лемуров, то их предками в действительности были древние приматы, близкие к адапидам, которые в эоценовую эпоху (около 55–34 млн лет назад) жили в Евразии, Африке и Северной Америке. Кто-то из представителей этой группы проник на Мадагаскар, дав начало адаптивной радиации лемуров (см. раздел «Биогеографические доказательства»). Нетрудно заметить, что случайный занос нескольких животных или даже всего одной беременной самки на удаленный остров — событие гораздо более вероятное, чем массовое переселение сотни видов. Не встречая конкуренции со стороны более продвинутых приматов, лемуры сохранились на Мадагаскаре, тогда как на «Большой земле» представители этой древней линии приматов вымерли, за исключением некоторых уцелевших в Азии и Африке архаичных форм, таких как долгопяты и лори.

Когда биологи говорят, что число имеющихся доказательств эволюции огромно, они имеют в виду следующее. Существует колоссальное количество фактов (результатов наблюдений, экспериментов), хорошо объясняемых (а часто и предсказываемых) эволюционной теорией, и гораздо хуже или вовсе не объясняемых (и не предсказываемых) идеей об отсутствии эволюции. Любой из этих фактов представляет собой доказательство (evidence) эволюции. Их действительно очень много — буквально миллионы. Они различаются как по степени сложности (для понимания многих из них требуется специальное образование), так и по степени убедительности. Убедительность доказательства — это статистическая, вероятностная величина, которую в ряде случаев можно точно измерить, а в других она может быть только оценена «на глазок». Главная проблема, стоящая перед авторами статьи о доказательствах эволюции — это проблема выбора. Какие из великого множества доказательств включить в относительно короткий текст, а какие опустить? Ведь для перечисления всех доказательств потребовалось бы написать, как минимум, колоссальный многотомный труд размером с Британскую энциклопедию (и то мы не уверены, что хватило бы места). Ясно, что для популярного текста нужно выбирать самые простые, понятные и при этом убедительные доказательства. И очень жалко, работая над таким текстом, пропускать множество еще более ярких и убедительных доказательств только потому, что они сложны и требуют долгих предварительных объяснений, или просто не помещаются в статью. Поэтому мыхотим особо подчеркнуть: доказательства, приведенные в данной статье — это далеко не всё, что у нас есть! И еще: необходимо иметь в виду, что имеющиеся на сегодняшний день доказательства эволюции более чем избыточны. Даже если бы у нас вовсе не было каких-то групп доказательств (например, ископаемой летописи), оставшихся свидетельств с лихвой хватило бы научному сообществу для того, чтобы признать эволюцию доказанным фактом. Нам очень повезло, что у нас есть палеонтологическая летопись, дающая весьма наглядные подтверждения эволюционного процесса. Но это — не необходимая часть доказательства эволюции, а «роскошь», приятное, хоть и необязательное, дополнение ко всему остальному.

Поэтому попытки «опровергнуть» эволюцию на основе того, что какой-то переходной формы до сих пор не нашли в ископаемой летописи — это полный абсурд.

Изначально мы использовали в качестве основы для этого текста очень добротную, относительно недавно появившуюся статью из русской Википедии, которая так и назвается — «Доказательства эволюции». В ходе работы нами вносились в текст многочисленные изменения, а многие разделы были написаны «с нуля», так что в конце концов от исходной википедийной статьи осталось не так уж много. В ранних версиях мы выделяли текст, заимствованный из Википедии, особым цветом, но впоследствии отказались от этой практики, полагая, что этот текст уже в достаточной мере нами переработан и расширен.

3. Общие замечания

Многочисленные доказательства эволюции подтверждают эволюционное происхождение всех живых существ от общего предка. Сегодня мы уже довольно много знаем о том, что представляло из себя последний общий предок всех ныне живущих организмов (см.: Последний универсальный общий предок). Нужно помнить, что этот предок не был: 1) ни первым живым организмом на Земле (его появлению предшествовала долгая эволюция), 2) ни самым примитивным или простым из когда-либо живших существ, ни 3) единственным существом, жившим в то время на Земле. Вместе с ним жило множество похожих на него существ, но в силу статистических обстоятельств — отчасти случайных, отчасти закономерных — именно он оказался ближайшим общим предком всех современных существ. В этом отношении этот предок схож с «митохондриальной Евой«, которая не была ни первой, ни единственной, ни самой примитивной, ни самой «приспособленной» из своих сородичей — ранних африканских Homo sapiens.

Следует также помнить, что мы сейчас говорим о доказательствах эволюции, а не о происхождении жизни. Это — отдельная тема, которой посвящены другие работы. Мы не будем здесь рассматривать вопрос о том, как появились РНК, ДНК, генетический код, белки и все прочее, из чего состояли первые живые клетки. В данной публикации мы рассматриваем существование первых одноклеточных организмов уже как данность. Мы делаем так вовсе не потому, что современная наука считает приемлемой гипотезу о Божественном сотворении первых одноклеточных форм жизни (как раз наоборот), а исключительно для того, чтобы хоть как-то ограничить круг рассматриваемых фактов и теорий. В данной публикации мы расматриваем факты, доказывающие, что существующие на планете виды живых существ не были созданы какой-либо разумной силой в своем нынешнем виде, а произошли от других видов в результате естественных процессов; что эти виды-предки, в свою очередь, произошли от других видов, и так далее, вплоть до Последнего универсального общего предка. Читателей, которые верят в то, что самые первые живые существа были сотворены, а не появились в результате естественных процессов, мы не будем пытаться переубедить, потому что это выходит за рамки нашей темы. В конце концов, вера в сотворение первого живого существа, которое затем эволюционировало самостоятельно, дав начало всему нынешнему многообразию жизни, наносит гораздо меньший ущерб реалистичной, основанной на научных фактах картине мира, чем вера в сотворение всех живых существ в их нынешнем виде. Сам Дарвин (в отличие от современной науки) допускал возможность сотворения жизни Богом, как видно из заключительной фразы его книги «О происхождении видов»:

«Есть величие в этом воззрении, по которому жизнь с ее различными проявлениями Творец первоначально вдохнул в одну или ограниченное число форм; и между тем как наша планета продолжает вращаться согласно неизменным законам тяготения, из такого простого начала развилось и продолжает развиваться бесконечное число самых прекрасных и самых изумительных форм.»

Эволюционные процессы наблюдаются как в естественных условиях, так и в лаборатории. Имеются документированные, непосредственно наблюдавшиеся человеком случаи образования новых видов (некоторые из этих случаев перечислены здесь (англ.)).

Факт эволюции доказан экспериментально. Чтобы получить сведения об эволюционной истории жизни, палеонтологи анализируют ископаемые останки организмов. Степень родства между современными видами можно установить сравнивая их строение, геномы, развитие эмбрионов (онтогенез). Еще один источник информации об эволюции — закономерности географического распространения животных и растений, которые изучает биогеография. Все эти данные укладываются в единую картину — эволюционное дерево жизни.

Чтобы понять эволюцию, необходимо прежде всего очень хорошо понять основную идею Дарвина — естественный отбор. Она только кажется простенькой, на самом деле осознать ее не так-то легко. Не случайно она была открыта человечеством позже, чем куда более сложные (казалось бы) вещи, такие как дифференциальное исчисление. Рекомендуем для этого книгу Ричарда Докинза «Слепой часовщик«(The Blind Watchmaker).

Многие случаи неприятия эволюции объясняются самым обычным недопониманием фундаментальных принципов эволюционного учения. Например, часто приходится слышать утверждения о том, что «эволюция невозможна, потому что сложные структуры не могут возникать в результате простой случайности». Сложные структуры действительно не могут возникать в результате случайности, но эволюция вовсе не является случайным процессом. «Случайными» являются только мутации, да и то не во всяком смысле, а только в очень конкретном: полезность или вредность данной мутации для организма, как правило, не влияет на вероятность возникновения этой мутации. Мутации возникают независимо от того, вредны они или полезны. Мутации создают «запас изменчивости» в популяции, они служат материалом для отбора. Что же касается самого отбора, то он — полная противоположность слепому случаю. Это строго закономерный процесс, придающий эволюции направленность и в конечном счете создающий сложные адаптации, похожие на результат «разумного проектирования». Сложные адпатации, как правило, возникают не в результате единичных крупных мутаций (хотя и такое в принципе возможно, см. раздел «Эво-дево: следы макроэволюции«), а в результате постепенного накопления множества мелких наследственных изменений. Действие отбора проявляется в том, что мутации полезные, то есть хоть немного повышающие эффективность размножения организма («приспособленность», или ожидаемое число оставляемых потомков), постепенно накапливаются в популяции, частота их встречаемости растет. Мутации, не оказывающие существенного влияния на приспособленность, могут долго сохраняться в популяции, причем их частота будет испытывать случайные колебания и в конце концов может достичь 100 % («мутация зафиксировалась») или 0 % («мутация элиминировалась»). Такие нейтральные наследственные вариации составляют значительную часть «запаса изменчивости» в большинстве популяций. При изменении условий среды какие-то мутации, прежде бывшие нейтральными, могут оказаться полезными или вредными. Вредные мутации, снижающие приспособленность организма, постепенно отбраковываются (их частота в популяции снижается автоматически, в силу того обстоятельства, что носители таких мутаций оставляют в среднем меньше потомства).

4. Возможность появления новых, полезных для организма признаков посредством случайных мутаций подтверждена многочисленными фактами

Противники эволюции часто утверждают, что мутации (случайные изменения ДНК) якобы всегда вредны и не могут приводить к появлению новых полезных свойств. Эти утверждения просто-напросто ошибочны, о чем свидетельствуют результаты множества тщательно выполненных исследований. Приведем несколько примеров из научных публикаций последних лет.

1) Способность к сложному коллективному поведению может возникнуть благодаря единственной мутации. Ученые из Института биологии развития им. Макса Планка (Тюбинген, Германия) на примере почвенной бактерии Myxococcus xanthus показали, что радикальные изменения коллективного поведения и межорганизменных взаимосвязей могут происходить в результате весьма незначительных модификаций генома. В экспериментах по искусственной эволюции удалось зарегистрировать мутацию, в результате которой бактерии Myxococcus xanthus приобрели сразу два полезных свойства: способность к сложному коллективному поведению (образованию плодовых тел) и защищенность от паразитов. Мутация состояла в замене одного нуклеотида в регуляторной области гена, предположительно участвующего в регуляции активности других генов.

2) Чтобы дикий рис превратился в культурный, хватило единственной мутации. Как и в случае с пшеницей, ключевым моментом в доместикации (окультуривании) риса было появление разновидности с неопадающими семенами, что позволило древним земледельцам резко сократить потери при сборе урожая. Ученые из Мичиганского университета (США) выявили генетическую подоплеку этого события. Появление культурного риса было обусловлено заменой одной-единственной аминокислоты в регуляторном белке, управляющем формированием «отделительного слоя» между зерном и плодоножкой. Закрепление этой мутации у риса было обусловлено бессознательным искусственным отбором. Данное событие можно рассматривать не только как создание человеком нового полезного человеку свойства у одомашненного растения, но и как появление у риса нового свойства, полезного для самого риса в новых условиях, когда его стали культивировать люди.

3) Чтобы превратить самок в гермафродитов, достаточно двух мутаций. Большинство круглых червей рода Caenorhabditis — это обычные раздельнополые виды, состоящие из самцов и самок. Однако у двух видов этого рода (C. elegans и C. briggsae) самок нет, а есть самцы и гермафродиты, способные к самооплодотворению. Эксперименты на раздельнополых червях C. remanei показали, что для превращения самок в полноценных гермафродитов достаточно уменьшить активность двух генов (tra-2 и swm-1). Это значит, что для появления нового признака — гермафродитизма — в эволюции червей рода Caenorhabditis было достаточно двух мутаций. Гермафродитизм полезен для этих червей, потому что облегчает заселение новых участков с подходящими для них условиями.

4) Возбудитель малярии приобрел устойчивость к хлорохину благодаря мутации в транспортном белке. Начиная с 1960-х годов по всему миру распространились штаммы малярийного плазмодия, устойчивые к хлорохину — лекарству, которое прежде было самым эффективным средством против малярии. Устойчивость обеспечивается несколькими мутациями в транспортном белке PfCRT. Австралийские исследователи экспериментально показали, что мутации придали этому белку способность транспортировать хлорохин через клеточную мембрану. В результате лекарство быстро выводится из пищеварительной вакуоли паразита, не вредя его здоровью.

5) Эволюция защитной окраски у мышей изучена на молекулярном уровне. Американские хомячки Peromyscus maniculatus в норме имеют темную окраску, однако представители этого вида, обитающие в районе с очень светлой почвой (Песчаные Холмы в штате Небраска), окрашены светлее своих сородичей. Это помогает им прятаться от хищных птиц. Генетический анализ показал, что данная адаптация возникла в результате единичной мутации в гене Agouti, влияющем на пигментацию волос.

6) Насекомые-вредители защищаются от биологического оружия. Вирус CpGV считался самым эффективным средством борьбы с яблонной плодожоркой — опаснейшим вредителем яблонь. Однако в последние годы в европейских садах появились и стали быстро распространяться вредители, устойчивые к вирусу. Германские генетики установили, что причиной устойчивости является мутация в половой хромосоме Z. Быстрое распространение мутации объясняется тем, что при низких концентрациях вируса она проявляется как доминантная, а при высоких — как рецессивная. Авторы подчеркивают, что борьба с подобными явлениями требует развития новой дисциплины — «прикладной эволюционной биологии».

7) «Тонкая подстройка» многофункционального гена может приводить к появлению новых признаков. Американские генетики расшифровали генетические основы многократного и независимого появления и утраты пятен на крыльях в ходе видообразования у мух-дрозофил. Оказалось, что все эти эволюционные изменения связаны с модификациями регуляторных участков многофункционального гена yellow, ответственного за пигментацию разных частей тела.

8) Изменение гена, необходимого для симбиоза растений с грибами, привело к формированию симбиоза с азотфиксирующими бактериями. Биологи из Германии и Великобритании показали, что один и тот же ген SYMRK необходим для успешного сожительства растений с тремя типами внутриклеточных корневых симбионтов: грибов (микориза), актинобактерий (актинориза) и бактерий-ризобий. Микориза появилась уже у первых наземных растений свыше 450 млн лет назад. Модификация гена SYMRK в одной из групп цветковых растений, произошедшая сравнительно недавно, открыла путь для приобретения новых внутриклеточных симбионтов — ризобий и актинобактерий.

Эти факты, как и многие другие, полностью опровергают один из типичных «доводов» антиэволюционистов, что мутации якобы всегда разрушительны и не могут приводить к появлению новых полезных свойств. Закрепляя, одну за другой, множество таких полезных мутаций, естественный отбор постепенно меняет облик живых существ, что и приводит со временем к появлению новых видов, родов и более крупных таксонов (подробнее о том, как из последовательности «микроэволюционных» изменений складываются «макроэволюционные» преобразования, см. в разделе «Палеонтологические доказательства«).

5. Изменения видов при доместикации (От искусственного отбора к естественному)

Во времена Дарвина образованной английской публике не нужно было объяснять, что такое отбор (= селекция, selection). Многие джентльмены увлекались селекцией собак, лошадей, голубей, различных растений, и не понаслышке знали, каких радикальных изменений в строении и внешнем облике организмов можно добиться — причем довольно быстро — путем отбора (отбраковки «неудачных» особей и размножения «удачных», что бы ни понимал под «удачностью» конкретный селекционер). Именно поэтому Дарвин и назвал открытое им явление «естественным отбором» (natural selection). Он хотел, чтобы все его соотечественники сразу поняли, о чем речь. Гениальная догадка Дарвина состояла в том, что в природе должен самопроизвольно идти процесс, полностью аналогичный тому, что происходит в голубятне эксперта-голубевода, выводящего новую породу. «Естественный отбор» — это, собственно говоря, метафора. Это не какая-то особая сущность, для которой необходимо было вводить специальный новый термин. Это не «гравитация» и не «сильное ядерное взаимодействие». Естественный отбор — это сочетание двух обстоятельств: 1) наследственной изменчивости и 2) дифференциального размножения. Особи в пределах каждого вида различаются по своим наследственным (врожденным) свойствам; некоторые из этих свойств влияют (статистически) на число потомков, оставляемых особью. Вот и всё! Можно было и не вводить специальный термин «естественный отбор», а просто говорить о «сочетании наследственной изменчивости и дифференциального размножения», хотя это, конечно, более громоздко и менее понятно. Любой селекционер-практик прекрасно знает, что особи одного и того же вида (например, собаки или голубя) сильно различаются по своим наследственным качествам. Оставляя «на развод» одних животных (например, самых длинноногих) и отбраковывая других, селекционер создает для своей «подопытной популяции» ситуацию, в которой вероятность успешного размножения особей зависит от определенного наследственного признака. С точки зрения отбираемых собак ситуация выглядит так: «чем длиннее твои ноги, тем больше у тебя шансов оставить потомство». В результате те генетические варианты (аллели), которые способствуют развитию длинных ног, распространяются в популяции, а «гены коротких ног» постепенно исчезают, выбраковываются. И мы получаем в итоге новую породу — например, борзую или гончую. Дарвин догадался, что точно такой же процесс должен сам собой происходить в природе. Например, если более длинноногие особи в данной популяции будут в среднем ловить больше зайцев, а следовательно — лучше питаться, а следовательно — будут сильнее и крепче, а следовательно — оставят в среднем больше потомства, чем их коротконогие сородичи. Разумный селекционер для этого вовсе и не нужен: природа все сделает сама. И в итоге мы получим новую естественную разновидность с ногами более длинными, чем у предков.

Значительная часть книги Дарвина «О происхождении видов«посвящена искусственному отбору, его результатам и возможностям. Позже Дарвин написал еще отдельную книгу об этом — «The Variation of Animals and Plants Under Domestication«. Логика очень проста:

— Искусственный отбор позволяет менять строение организмов и создавать новые разновидности;

— В природе должен самопроизвольно происходить (и происходит) практически точно такой же процесс;

— Следовательно, в природе должны самопроизвольно появляться новые разновидности.

Между искусственным и естественным отбором нет непроходимой пропасти

Многие антиэволюционисты — и даже, как ни странно, отдельные эволюционисты — считают, что между искусственным и естественным отбором существует принципиальная разница, поскольку в первом случае направление отбора задает разумный агент, а во втором его задают «слепые силы природы». Но эта разница на самом деле вовсе не принципиальна.

Во первых, в большинстве случаев новые породы домашних животных и культурных растений выводились людьми совершенно бессознательно, без всякого умысла. То есть человек действовал в ходе селекции тоже не как «разумный агент», а как «слепая природная сила». Примеры:

1) Для людей, занимающихся молочным животноводством, совершенно естественно оставить корову, которая дает много молока, в живых, а ту, что дает мало молока, пустить на мясо. Это естественным образом приводит к тому, что высокоудойные коровы будут оставлять больше потомства, и, следовательно, будет идти отбор на удойность. Людям при этом совершенно не обязательно осознавать, что они занимаются селекцией.

2) Важнейшим отличием культурных злаков (пшеницы, риса и др.) от дикорастущих предков является то, что у первых семена лучше держатся в колосе, а у вторых — очень легко осыпаются. Древние земледельцы просто не доносили до дома (места молотьбы и т. п.) те семена, которые обсыпались в пути, пока люди несли срезанные серпами колосья. Им доставались только те семена, которые лучше держались в колосе. Эти же семена использовались потом для очередного посева. Таким образом, происходил бессознательный отбор растений с неосыпающимися семенами. Подробнее об этом см. в заметках:

• Чтобы дикий рис превратился в культурный, хватило единственной мутации;

• Пшеница не сразу окультурилась.

3) Совершенно бессознательно и даже вовсе о том не ведая, виноделы, пивовары и пекари за несколько тысячелетий «вывели» ряд специфических разновидностей дрожжей — винных, пивных и хлебопекарных (см., например: Legras et al., 2007. Bread, beer and wine: Saccharomyces cerevisiae diversity reflects human history; Fay J.C., Benavides J.A., 2005. Evidence for Domesticated and Wild Populations of Saccharomyces cerevisiae. PLoS Gen 1 (1): e5).

Во-вторых, между искусственным и естественным отбором есть ряд переходных, промежуточных состояний. В природе агенты отбора тоже далеко не всегда являются «слепыми» и «бессознательными» силами. Яркий пример — сельское хозяйство у насекомых. Некоторые муравьи и термиты имеют сложную и высокоразвитую агрикультуру. Разводя в своих муравейниках и термитниках грибы на специально обустроенных «огородах», насекомые в течение тысяч и миллионов лет осуществляли самую настоящую селекцию своих сельскохозяйственных культур. В результате, например, возделываемые термитами грибы полностью утратили способность к самостоятельной жизни; эти грибы выделяются микологами в особый род Termitomyces. Об удивительных подробностях сельскохозяйственной деятельности и искусственного отбора у насекомых-грибоводов см. в заметках:

• Муравьи-листорезы приручили бактерий для борьбы с вредителем

• Выращивание монокультур — ключ к эффективности сельского хозяйства у термитов

• Муравьи используют азотные удобрения для своих угодий

• Для повышения эффективности труда муравьи формируют узких специалистов.

• Симбиотические бактерии помогают жукам выращивать съедобные грибы

Вовсе не являются «слепыми и стихийными» агенты отбора и в том случае, когда речь идет о половом отборе (когда, например, ожидаемое число потомков, оставляемых самцом, зависит от того, насколько этот самец нравится самкам). В этом случае отбор направляют существа, у которых всё же есть кое-какие мозги. Эти существа способны к целенаправленным действиям и отчасти осмысленным решениям. Самки становятся селекционерами. Привередливые павлинихи создали роскошные узоры на хвостах самцов-павлинов точно так же, как голубеводы создали причудливые украшения у декоративных пород голубей. Подробнее об этом см. в заметке:

• Женская привередливость способствует видообразованию

Совершенно аналогичным образом красота и приятный запах многих цветов являются результатом отбора (естественного? искусственного? даже не поймешь), осуществляемого насекомыми-опылителями. Цветы, сумевшие привлечь больше опылителей, передадут свою пыльцу большему количеству других цветов и потому оставят больше потомства. Таким образом, происходит отбор на способность привлекать опылителей. Направленность этого отбора задается особенностями поведения, предпочтениями и вкусами насекомых. Красота и аромат диких цветов «созданы» насекомыми точно в том же самом смысле, в каком красота одомашненных цветов создана (а точнее, улучшена) селекционерами — людьми.

Нам, кстати, просто повезло, что наши вкусы во многом совпадают со вкусами значительной части насекомых. Это сходство вкусов объясняется в конечном счете историческим сходством диеты: приматы (как и многие насекомые) обожают сладенькое, потому что важную часть их диеты издавна составляли спелые фрукты. Собаке или кошке сладкие ароматы цветов глубоко безразличны или даже неприятны. Зато нам совсем не нравится аромат тухлого мяса, источаемый некоторыми цветами, опыляемыми навозными мухами. Кроме того, красота многих цветов и птиц недоступна нам в полном объеме, потому что значительная часть их орнаментов «выполнена» в ультрафиолетовом диапазоне, который нам недоступен, но зато отлично виден многим насекомым и птицам. Этот факт, помимо прочего, доказывает, что красота их не была создана специально для ублажения нашего взора, как наивно считают некоторые антиэволюционисты.

Многочисленные случаи «эволюционной гонки вооружений» тоже наглядно показывают, что направленность отбора часто задается вовсе не «слепыми стихийными силами», а целенаправленным (и тоже развившимся в результате отбора) поведением других живых существ. Так, газели, убегая от гепардов, осуществляют селекцию гепардов по признаку «скорость бега», и ту же самую операцию проделывают гепарды в отношении газелей. Другие примеры «эволюционной гонки вооружений» см. в разделе «Этические и эстетические аргументы«.

Таким образом, естественный отбор, осуществляемый «слепыми» силами природы (например, когда изменение цвета почвы стимулирует изменение окраски у мышей, см.: Эволюция защитной окраски у мышей изучена на молекулярном уровне) представляет собой лишь крайнюю область непрерывного спектра разных форм отбора — от совершенно «сознательного» искусственного отбора до полностью «бессознательной» селекции, осуществляемой абиотическими (неживыми) факторами среды. Кстати, даже и в приведенном только что примере отбор на самом деле осуществлялся не цветом почвы как таковым, а хищниками, которые лучше видят на светлом фоне темных мышей, чем светлых. Эти рассуждения наглядно демонстрируют несостоятельность доводов антиэволюционистов о том, что искусственный отбор якобы «не имеет ничего общего с реальными природными процессами».

Антиэволюционисты иногда пытаются оспаривать реальность естественного отбора в природе, утверждая, что в действительности выживаемость и репродуктивный успех особей не зависят от наследственной изменчивости в природных популяциях. Этот «аргумент» встречается довольно редко, поэтому мы сочли излишним подробно обосновывать его несостоятельность. Существует огромный массив научных фактов, доказывающих, что естественный отбор в природе реально происходит. Ознакомиться с этими фактами можно, например, сделав поиск в Google Scholar по словам «Natural selection in thе wild» (естественный отбор в природе).

Антиэволюционисты ошибаются, когда говорят, что искусственный отбор не создал ни одного нового вида

Люди занимаются селекцией (в основном бессознательной) животных и растений лишь около 10 000 лет (не считая собаки, которая была одомашнена немного раньше) — срок ничтожный по сравнению со временем существования земной жизни (свыше 3,8 млрд лет) и по сравнению с наблюдаемыми в природе естественными темпами видообразования (средняя продолжительность существования вида в природе — порядка 1–3 миллионов лет; на развитие полной генетической несовместимости между двумя разобщенными популяциями уходит в среднем около 3 млн лет). Тем не менее достигнутые за этот ничтожный срок результаты весьма впечатляющи.

Излюбленный «довод» антиэволюционистов звучит примерно так: «Собака волк осталасься собакой волком». Последовательный антиэволюционист, глядя на карликового пуделя, должен твердо стоять на том, что перед ним — просто волк, Canis lupus, который за 15 000 лет селекции так и не перестал быть «просто волком».

Антиэволюционисты любят говорить, что искусственный отбор якобы так и не смог создать ни одного нового вида. При этом они используют свой характерный прием — игру в слова («сколько бы люди ни создали новых пород собак, собака все равно осталась собакой»). Это действительно не более чем игра в слова, потому что любой непредвзятый биолог-систематик, обнаружив в природе, например, дикую таксу, никогда в жизни не объединил бы ее в один вид с дикой афганской овчаркой или серым волком. Понятие «вид» вообще с трудом приложимо к домашним животным, да оно и по сути своей неизбежно является весьма расплывчатым. Тем не менее биологи традиционно относили собаку и волка к разным видам (Canis familiaris и Canis lupus). Между тем генетики доказали, что все домашние собаки происходят от небольшого количества волков, одомашненных в Восточной Азии около 15 000 лет назад (Savolainen et al., 2002. Genetic Evidence for an East Asian Origin of Domestic Dogs). Австралийская собака динго — потомок одичавших несколько тысяч лет назад домашних собак, завезенных с Малайского архипелага древними мореплавателями — традиционно тоже считалась особым видом (Canis dingo). С точки зрения морфологии, экологии и поведения этих животных, а также устоявшихся традиций зоологической классификации, такое разделение абсолютно оправдано. Лишь совсем недавно, на основе новых генетических данных, показавших большую генетическую близость этих видов, их стали чаще характеризовать как подвиды одного и того же вида. Но это ведь не более чем условность, результат некого зыбкого консенсуса между специалистами! Если к представителям рода Canis попытаться последовательно и формально применить, например, такой критерий вида, как генетическая несовместмость (нескрещиваемость), то получим абсурд: все виды этого рода придется считать одним и тем же видом (собак, волков, шакалов, койотов и др.) (см. также: The evolution and history of wolves). И это не исключение, а правило: очень многие виды диких животных, относящиеся к одному роду, а иногда и к разным родам, в принципе способны скрещиваться и давать плодовитое потомство, однако в естественных условиях они почти никогда этого не делают. Потому-то их и считают разными видами.

Обычно генетики так радуются, когда им удается строго обосновать происхождение одного вида от другого (например, собаки от волка), что они стараются подчеркнуть силу своих аргументов, настаивая на формальном объединении этих видов в один. При этом они невольно делают «подарок» антиэволюционистам, давая им номенклатурный повод для утверждений типа «раз это один вид, то и никакой эволюции не было». Происходит это потому, что среди профессиональных биологов никакого антиэволюционизма давно уже нет и в помине, а о существовании за пределами научного сообщества активной антиэволюционистской агитации профессиональные биологи обычно просто не помнят и практически никогда не считаются с этим обстоятельством. Тот период в истории науки, когда был актуален поиск новых доказательств эволюции, закончился примерно 80 лет назад, когда данные генетики удалось объединить с классическим дарвинизмом в т. н. «синтетическую теорию эволюции». Сейчас уже никто специально не ищет новых доказательств, они ученым просто не нужны: факт эволюции давно доказан. Серьезный биологический журнал не примет статью с названием «Найдено новое доказательство эволюции», потому что справедливо сочтет, что в этом нет научной новизны. Поэтому сегодня генетикам гораздо важнее пропиарить свое конкретное новое открытие (например, новооткрытые доказательства происхождения собаки от волка, а не от шакала или кого-то еще), чем позаботиться о том, чтобы не «кормить» антиэволюционистов, которых ученые в большинстве случаев просто не принимают в расчет.

Специалисты по систематике млекопитающих всегда считали двумя разными видами домашнюю корову (Bos taurus) и ее дикого предка тура (Bos primigenius), последние экземпляры которого были убиты во время королевских охот в заповедниках Речи Посполитой в XVII веке. Таким образом, домашняя корова — это новый вид, созданный искусственным отбором. Напротив, домашняя свинья и ее предок дикий кабан не так сильно отличаются друг от друга, и их поэтому традиционно относят к одному и тому же виду Sus scrofa (см. также: Генетики выяснили, откуда в Европе свиньи). Впрочем, выведенные недавно очаровательные комнатные свинки свидетельствуют о том, что и на свиней искусственный отбор может оказывать весьма радикальное действие.

Мы бы очень хотели увидеть своими глазами, как антиэволюционисты, внимательно рассмотрев этот рисунок, твердят свою заученную мантру: капуста осталась капустой… капуста осталась капустой…

Растение теосинте — малоизменившийся потомок дикого предка кукурузы


Кукуруза — одно из ярких живых свидетельств могущества искусственного отбора. Дикий предок кукурузы — растение теосинте — имело крошечный початок с небольшим числом мелких семян в жесткой, малосъедобной оболочке. Несколько тысячелетий искусственного отбора превратили теосинте в кукурузу. Ботаники традиционно относили теосинте и кукурузу не только к разным видам, но и кразным родам (соответственно, Euchlaena и Zea). Так, в Большой Советской Энциклопедии читаем: «Теосинте — виды растений семейства злаков из рода эвхлена (Euchlaena).» Происхождение кукурузы от теосинте было доказано не так давно, так что даже сейчас среди уфологов в ходу байки о том, что кукурузу якобы занесли на землю инопланетяне, потому что у нее нет диких родственников (этакий специфический вариант «разумного дизайна»). Лишь в 1977 году на основании новых данных было принято решение включить теосинте в род Zea (кукуруза). Что, впрочем, нисколько не умаляет радикальных различий между кукурузой и ее диким предком — различий, созданных искусственным отбором.

Еще один яркий пример эффективности отбора был получен в знаменитых опытах Д.К.Беляева по одомашниванию черно-бурых лисиц, подробно описанных в популярной статье Л.Н.Трут «Обретет ли человек нового друга?» (Природа, № 6, 2007). Уже после шести поколений отбора на дружелюбное отношение к человеку в подопытной популяции лисиц стали появляться особи, своим поведением и даже внешними признаками (окраска, вислоухость, хвост бубликом и др.) напоминающие домашних собак (см. также: Беляев Д. К. Генетические аспекты доместикации животных).

Таким образом, вопреки утверждениям антиэволюционистов, искусственный отбор может создавать новые виды — при любом осмысленном понимании расплывчатого термина «биологический вид». Ну а дальше действует старая добрая «дарвиновская» логика: поскольку естественный отбор по сути дела является тем же самым процессом, что и искусственный, то и в природе могут из старых видов самопроизвольно возникать новые. Причем у природы было на это не 10 000 лет, как у человека, а свыше трех миллиардов, т. е. в 300 000 раз больше.

Часть II. Группы доказательств

1. Наблюдаемая эволюция

Наблюдаемые мутации как основа эволюционных новшеств

Наблюдаемые сегодня изменения в популяциях доказывают не только существование эволюции, но и существование ряда механизмов, необходимых для эволюционного происхождения всех видов от общего предка. Было установлено, что геномы подвержены разнообразным мутациям, среди которых перемещение интронов, дупликация генов, рекомбинации, транспозиции, ретровирусные вставки, горизонтальный перенос генов, замена, удаление и вставка отдельных нуклеотидов, а также хромосомные перестройки.

Один из аргументов антиэволюционистов состоит в том, что разное число хромосом у разных видов якобы доказывает невозможность эволюционного превращения одного вида в другой, потому что виды с разным числом хромосом не могут скрещиваться, и мутант, у которого число хромосом изменилось, не оставит потомства, потому что не найдет себе брачного партнера с такой же мутацией. Ошибочность этого довода доказывается тем, что различия в числе хромосом на самом деле не являются непреодолимым препятствием для скрещивания и производства плодовитого потомства. Известны виды организмов (растений, насекомых, млекопитающих и др.) у которых наблюдается внутривидовая изменчивость по числу хромосом, причем особи с разным числом хромосом скрещиваются и дают нормальное плодовитое потомство. Один из примеров — дикие кабаны, у которых имеется значительный хромосомный полиморфизм (Nombela et al., 1990)

Весьма интересны недавние открытия, показывающие роль дупликации генов в формировании эволюционных новшеств:

1) Многофункциональные гены — основа для эволюционных новшеств

2) Геном ланцетника помог раскрыть секрет эволюционного успеха позвоночных

3) Обоняние и цветное зрение в эволюции млекопитающих развивались в противофазе

4) Прослежена эволюционная история одного из человеческих генов

5) Утрата полового размножения способствует появлению новых генов

6) Удвоение генов может приводить к видообразованию

Появление эволюционных новшеств («новой сложности») путем удвоения гена и последующего разделения функций между его копиями опровергает утверждения антиэволюционистов о том, что усложнение живых систем требует вмешательства разумной силы.

Также наблюдается изменение морфологии организмов и функциональные изменения — различные адаптации, появление способности усваивать новый вид пищи (в том числе — нейлон и пентахлорфенол, производство которых началось в 30-х годах прошлого века) и т. д… Кроме того, были обнаружены всевозможные промежуточные этапы видообразования, что свидетельствует о плавном характере возникновения новых видов.

Долгосрочный эволюционный эксперимент

Группе биологов из Университета штата Мичиган под руководством Ричарда Ленски удалось смоделировать в лаборатории процесс эволюции живых организмов на примере бактерий кишечной палочки Escherichia coli (см. E. coli long-term evolution experiment). Опыт был начат в 1988 году.

В силу скорости размножения смена поколений кишечной палочки происходит крайне быстро, поэтому ученые надеялись, что длительное наблюдение продемонстрирует механизмы эволюции в действии. На первом этапе эксперимента, в 1988 году, 12 колоний бактерий были помещены в идентичные условия: изолированную питательную среду, в которой присутствовал только один источник питательных веществ — глюкоза. Кроме этого, в среде был цитрат, который в присутствии кислорода эти бактерии не могут использовать в качестве источника пищи. За прошедшие двадцать лет сменилось более 44 тысяч поколений бактерий.

Ученые наблюдали за изменениями, происходящими с бактериями. Большинство из них носили одинаковый характер во всех популяциях — например, размер бактерий увеличивался, хотя и разными темпами. Однако где-то между поколениями номер 31 тысяча и 32 тысячи в одной из популяций произошли кардинальные изменения, не наблюдавшиеся в остальных. Бактерии стали способны усваивать цитрат.

Используя сохраненные образцы бактерий из различных поколений, исследователям удалось установить, что начало серии изменений, которые привели к образованию новой разновидности бактерий, произошло в районе поколения номер 20 тысяч и только в этой колонии (см: Bob Holmes Bacteria make major evolutionary shift in the lab (англ.). New Scientist (9 июня 2008).

В ноябре 2009 года в большой статье в журнале Nature авторы подвели промежуточные итоги своего грандиозного эксперимента и сообщили о ряде удивительных подробностей. См.: Подведены итоги эволюционного эксперимента длиной в 40 000 поколений.

Другие работы по изучению эволюции в лабораторных условиях (каждая из этих работ сама по себе является весомым доказательством реальности эволюции):

1) Микробиологи утверждают: многоклеточность — сплошное жульничество

2) Начальные этапы видообразования воспроизведены в эксперименте на дрожжах

3) Для видообразования достаточно одного гена

4) Опыты на червях доказали, что самцы — вещь полезная

Примеры работ по химической «эволюции в пробирке» (эти работы доказывают эффективность механизма естественного отбора не только для организмов, но и для размножающихся молекул, что имеет прямое отношение к самым ранним этапам эволюции жизни):

1) Эволюция под управлением компьютера

2) Искусственный белок поможет победить ВИЧ

Развитие устойчивости к антибиотикам и пестицидам

Развитие и распространение устойчивых к антибиотикам бактерий и устойчивых к пестицидам растений и насекомых является доказательством эволюции видов. Появление устойчивых к ванкомицину форм золотистого стафилококка и та опасность, которую они представляют для пациентов больниц, это прямой результат эволюции путем естественного отбора. Еще один пример — развитие штаммов шигеллы, устойчивых к антибиотикам из группы сульфаниламидов. Появление малярийных комаров, устойчивых к ДДТ, и развитие у австралийских популяций кроликов устойчивости к миксоматозу демонстрируют действие эволюции в условиях давления отбора при быстрой смене поколений.

Естественный отбор также приводит к развитию устойчивости животных к естественным ядам, вирусам и прочим паразитам. Свежие примеры:

1) Насекомые-вредители защищаются от биологического оружия

2) Пути эволюции предопределены на молекулярном уровне (молекулярный механизм формирования у бактерий устойчивости к антибиотикам)

3) Неядовитые змеи вырабатывают устойчивость к смертоносному яду тритонов

4) Найден ген, защищающий от туберкулеза

5) Амёбы-мутанты не позволяют себя обманывать

В последнее время все большее число антиэволюционистов под давлением неопровержимых фактов, которые даже они не могут отрицать, сдают свои передовые рубежи и отступают на «запасную линию обороны», заявляя примерно следующее: «Ладно, Бог с вами, мы согласны, что микроэволюция (изменения внутри вида) возможна. Но макроэволюцию — превращение одного вида в другой — мы все равно отрицаем». В ответ на приводимые биологами доказательства превращения одного вида в другой антиэволюционисты обычно заявляют: «ну, значит, это не два разных вида, а один и тот же вид». Поскольку четкого и строго определения вида нет (и быть не может, т. к. виды постепенно эволюционируют и перетекают один в другой подчас весьма плавно и постепенно), такая аргументация оказывается принципиально непроверяемой, нефальсифицируемой, т. е. не научной. Однако у биологов есть и неопровержимые доказательства превращения друг в друга таких форм, про которые не может быть двух разных мнений: это однозначно разные виды и даже порой разные роды (хороший пример — рыбы-цихлиды африканских озер, см.: Эволюция цветного зрения у африканских цихлид шла двумя путями). В ответ на это самые продвинутые и изощренные креационисты выдвинули концепцию «бараминов» — «сотворенных родов». Барамин — это уже самая что ни на есть распоследняя зацепка антиэволюционистов за реальность, дальше отступать им некуда — разве что в полное мракобесие и потерю рациональности (по принципу «верую, ибо абсурдно»). Согласно этой концепции, Бог сотворил большое количество разных живых существ, дав каждому возможность самостоятельно эволюционировать в неких довольно узких пределах. «Барамин» с течением времени может превратиться в пучок близкородственных видов, но дальше этого дело не пойдет никогда. «Муха останется мухой, цихлида — цихлидой, собака — собакой». Главная слабость идеи бараминов состоит в том, что из нее вытекает проверяемое следствие, которое не подверждается фактами. Следствие это состоит в том, что между «бараминами» должны быть четкие, хорошо видимые границы. Эволюционирующие виды должны «биться» о границы бараминов, никогда не выходя за них. Такие границы в природе должны быть повсеместным, всеобщим явлением, но мы этого не наблюдаем. Отдельные разрывы (хиатусы), разумеется, есть, но концепция бараминов предсказывает повсеместность таких разрывов. Однако четких, вездесущих границ между воображаемыми «бараминами» нет ни в систематике, ни в морфологии организмов, ни в сравнительной геномике, ни в биохимии, их не видно на дендрограммах сходства, построенных любыми известными методами (см. ниже в разделе «Эволюционное дерево»). И, разумеется, нет их в палеонтологической летописи, изобилующей переходными формами между крупными подразделениями (таксонами) органического мира. На практике антиэволюционисты обычно настаивают на том, что виды А и Б относятся к разным бараминам до тех пор, пока их не ткнут носом в неопровержимые доказательства родства этих видов. Тогда они говорят: «ну ладно, так и быть, значит, это один и тот же барамин». Рассмотрим пример с породами собак. «Собака осталась собакой» — любят повторять антиэволюционисты. Но генетики уже однозначно доказали, что домашние собаки происходят от волка. Значит, волк и собака — одно и то же, один и тот же барамин, говорят антиэволюционисты. А как тогда быть с шакалами и койотами, которые свободно скрещиваются с собаками и дают плодовитое гибридное потомство? Ну, значит, все они — один и тот же барамин. Мы не знаем, говорят они, какие еще виды входят в этот барамин, но если биологи докажут родство этих видов с собаками, это и будет означать, что это один и тот же барамин, а если не докажут — значит, разные барамины. Ненаучность такой аргументации очевидна. Например, сравнительная генетика доказывает родство собак с волками с абсолютно той же самой (фактически стопроцентной) степенью достоверности, что и родство их с лисами, кошками, гиенами и так далее. Антиэволюционисты ошибаются, полагая, что генетические доказательства родства быстро слабеют по мере уменьшения степени этого родства. Анализ ДНК позволяет установить отцовство — с этим даже антиэволюционисты не решаются уже спорить, но точно так же анализ ДНК позволяет установить происхождение двух особей от более далекого общего предка. Например, сейчас осуществляется активный — и весьма успешный — поиск потомков Чингисхана по всей Азии (у Чингисхана или кого-то из его ближайших предков по мужской линии произошла оригинальная мутация в У-хромосоме, что очень облегчает такой поиск) (ссылка и ссылка). Таким же способом можно установить наличие и более далекого, фактически — сколь угодно далекого общего предка, вплоть до Последнего универсального общего предка (см. выше). Анализ ДНК свидетельствует о происхождении всех ныне живущих организмов от одного общего предка. Поэтому, признав микроэволюцию, вы получаете макроэволюцию бесплатно, в виде принудительного бонуса. Не хотите — тогда доказывайте, что анализ ДНК не годится для установления отцовства.

Биолога Алексея Оскольского донимал один антиэволюционист, напиравший на «отсутствие переходных форм». Оскольский спросил его: «Между тобой и твоими родителями тоже нет переходных форм, как же доказать, что именно эти люди являются твоими родителями? — «ДНК посмотреть», — не задумываясь, ответил антиэволюционист. «Ну так вот у человека и шимпанзе тоже можно ДНК посмотреть», — сказал Оскольский. Оппонента проняло.

Примеры видообразования

Судя по палеонтологической летописи и по измерениям скорости мутаций, полная репродуктивная изоляция (несовместимость геномов) достигается в природе в среднем за 3 миллиона лет. Иногда больше: например, у африканских цихлид на это уходит обычно от 4 до 14 млн лет. Однако на практике биологи в большинстве случаев считают разными видами такие группы особей, которые не скрещиваются или почти не скрещиваются в природе, независимо от того, могут ли они скрещиваться в принципе. Например, тетерев и глухарь — бесспорно разные виды, хотя в принципе могут скрещиваться и давать плодовитое потомство. Другие примеры: собака, волк и шакал; очень многие виды оленей; большинство видов и даже родов африканских цихлид. Поэтому ключевым событием в видообразовании является появление не «полной» изоляции (генетической несовместимости), а фактической изоляции, когда особи из двух популяций перестают скрещиваться в природных условиях, даже если проживают на одной территории. А значит, наблюдение образования нового вида в естественных условиях в принципе возможно, но это редкое событие. Например, рассчитано, что одних только жуков появляется в среднем по два новых вида в столетие (см.: Невероятное разнообразие жуков получило эволюционное объяснение) В то же время, в лабораторных условиях скорость эволюционных изменений может быть увеличена, поэтому ученым неоднократно удалось зафиксировать основные этапы видообразования у лабораторных животных (см. ниже: Опыты по искусственному видообразованию).

Известны многие случаи видообразования посредством гибридизации и полиплоидизации у таких растений, как конопля, крапива, первоцвет, редька, капуста, а также у различных видов папоротников. У растений видообразование в природе часто происходит в результате межвидовой гибридизации и последующей полиплоидизации (удвоения хромосомного набора). Этот механизм видообразования интересен тем, что он ведет к мгновенному и автоматическому формированию полной генетической несовместимости нового вида с видами-предками. В ряде случаев видообразование у растений происходило без гибридизации и полиплоидизации (кукуруза, Stephanomeria malheurensis).

Дрозофилы, также известные как плодовые мушки, входят в число наиболее изученных организмов. С 70-х годов детально изучены многие случаи видообразования у дрозофил, а отдельные этапы видообразования воспроизведены в экспериментах. Видообразование происходило в частности за счет пространственного разделения, разделения по экологическим нишам в одном ареале, изменения поведения при спаривании, дизруптивного отбора (= отбора на расхождение), а также за счет эффекта бутылочного горлышка (в ходе экспериментов founder-flush).

Видообразование наблюдалось в лабораторных популяциях комнатных мух, мух Eurosta solidaginis, яблонных мух-пестрокрылок, мучных жуков, комаров и других насекомых. Зелёные водоросли и бактерии были классифицированы как отдельные виды из-за превращения одноклеточных в многоклеточные и из-за изменения строения, такого как превращение коротких отростков в длинные — все это в результате давления отбора.

Видообразование также наблюдалось и у млекопитающих. Шесть случаев видообразования у домовых мышей на острове Мадейра за последние 500 лет были следствием географической изоляции, генетического дрейфа и слияния хромосом. Слияние двух хромосом — это наиболее заметное различие геномов человека и шимпанзе, а у некоторых мадейрских мышей за 500 лет было девять подобных слияний (Britton-Davidian et al., 2000).

Яблонные мухи

Яблонные мухи-пестрокрылки Rhagoletis pomonella, а также паразитирующие на них наездники Diachasma являются примером наблюдаемого симпатрического видообразования (= видообразования без разделения популяции физическими барьерами). Первоначально вид обитал в восточной части США. До появления европейцев личинки этих мух развивались только в плодах боярышника. Однако с завозом в Америку яблонь (первое упоминание яблонь в Америке — 1647 год), открылась новая экологическая ниша. В 1864 году личинки Rhagoletis pomonella были обнаружены в яблоках, тем самым зафиксирована яблонная раса этого вида. За полтора века наблюдений расы очень сильно разошлись. Они почти не скрещиваются друг с другом (уровень гибридизации не превышает 4–6 %). Яблоневая раса спаривается почти исключительно на яблонях, а боярышниковая — на боярышнике, что, учитывая разное время созревания плодов, приводит к репродуктивной изоляции. Подробный «разбор полетов» яблонной мухи и ее паразитов-наездников см. в заметке: «Цепная реакция видообразования«.

У пестрокрылок известно еще несколько видов-двойников, которые живут на разных видах растений — предположительно, видообразование у них протекало именно по описанной схеме (см. также: Для видообразования достаточно одного гена).

Другие хорошо документированные случаи симпатрического видообразования в природе

1) Рыбы Amphilophus citrinellus и A. zaliosus в озере Апойо в Никарагуа (Для видообразования не нужны барьеры).

2) Пальмы Howea forsteriana и H. belmoreana на острове Лорд-Хау в 580 км от восточного побережья Австралии (Эволюция без преград: ботаники нашли новое доказательство видообразования без географических барьеров).

3) Бабочки Heliconius в Центральной и Южной Америке (Зафиксирован начальный этап видообразования у тропических бабочек)

4) Трехиглая колюшка Gasterosteus aculeatus, подразделившаяся на два вида — донный и пелагический — в озерах Канады (Экспериментально подтверждено влияние видообразования на свойства экосистем).

5) Вьюрки Nesospiza acunhae и N. wilkinsi на островах Тристан-да-Кунья (Видообразование на разных островах идет параллельными путями).

6) Палочник Timema cristinae (Sandoval, 2008).

7) Стеблевой мотылек Ostrinia nubilalis.

8) Рыбы-цихлиды рода Pundamilia (Carleton et al., 2005).

9) Морская улитка Littorina saxatilis (Cruz et al., 2004).

10) Растения Mimulus lewisii и M. cardinalis.

11) Бабочка-листовертка Zeiraphera diniana (Emelianov et al., 2001).

12) Гороховая тля Acyrthosiphon pisum (Frantz et al., 2009).

13) Рыба Gambusia hubbsi (Langerhans et al., 2007).

14) Растение Anthoxanthum odoratum (Snaydon & Davies, 1976).

15) Рыбы Hypoplectrus (Puebla et al., 2007).

16) Рыбы-усачи озера Тана в Эфиопии (Sibbing et al., 1998).

Опыты по искусственному видообразованию (формирование репродуктивной изоляции)

Опыты по выращиванию тлей Dysaphis на «стрессовых» субстратах (малопригодных и непригодных кормовых растениях). В известных опытах, проведенных Г.Х.Шапошниковым (1961, 1965, 1966), популяция тлей Dysaphis anthrisci maicopica была пересажена с того кормового растения, на котором в природе развивается данный вид (Anthriscus nemorosa), на другое, малопригодное кормовое растение Chaerophyllum bulbosum, а затем на ранее совсем непригодное Ch. maculatum. После каждого пересаживания вначале наблюдался «кризисный» период, во время которого резко повышалась смертность и росла изменчивость. Затем популяция приспосабливалась к новым условиям: смертность и изменчивость снижались, формировалась новая «адаптивная норма», отличная от прежней. У особей преобразованной популяции обнаружилась репродуктивная несовместимость с исходной (контрольной) популяцией, не подвергавшейся воздействию стрессовых условий. Что еще более удивительно, появилась частичная совместимость с другим видом тлей, D. chaerophyllina, который является исконным обитателем растения Ch. maculatum.

Результаты экспериментов Шапошникова позже были частично воспроизведены В.Б.Сапуновым (1983) в новых опытах с тлями.

Опыты по дизруптивному отбору (отбору на расхождение). Почти одновременно с работами Шапошникова были опубликованы результаты экспериментов на Drosophila melanogaster по искусственному дизруптивному отбору по количественным признакам (количество щетинок). Особи с максимальными и минимальными значениями признака сохранялись, промежуточные отбраковывались. В результате между расходящимися частями популяции («много-» и «малощетинковыми» мухами) возникла частичная прекопуляционная изоляция (Thoday, Gibson, 1962).

Похожие опыты были проведены на мухах Cyrtodiopsis dalmanni. У самцов этого вида глаза расположены на длинных стебельках. Данный признак поддерживается половым отбором. В эксперименте производился искусственный отбор: в одних линиях отбирались самцы с максимальным расстоянием между глазами, в других — с минимальным. Удалось вывести линии, сильно различающиеся по этому признаку. Затем были исследованы половые предпочтения самок в разных линиях. Оказалось, что в контрольных (не подвергавшихся отбору) и в «длинностебельковых» линиях самки предпочитают самцов с наибольшим расстоянием между глазами, тогда как в «короткостебельковых» линиях предпочтения самок изменились на противоположные: они стали предпочитать самцов с самыми короткими глазными стебельками. В результате между линиями возникла прекопуляционная (поведенческая) изоляция (Wilkinson, Reillo, 1994).

Опыты по выращиванию Drosophila pseudoobscura на «стрессовых» средах. Опыты, сходные с экспериментами Шапошникова, позднее были проведены рядом зарубежных исследователей. Результаты получились в целом похожие, однако вскрылись некоторые новые существенные моменты, свидетельствующие о неслучайном характере изменения половых предпочтений. Рассмотрим результаты, полученные Д. Додд (Dodd, 1989) в опытах с мухами вида Drosophila pseudoobscura.

Из одной природной популяции этого вида, обитавшей в каньоне Брайс (Bryce Canyon, штат Юта, США) было произведено восемь лабораторных популяций, содержавшихся изолированно. Четыре популяции выращивались на среде, основанной на крахмале, четыре другие — на мальтозе. Обе эти среды являются для данного вида малопригодными (стрессовыми). Поначалу наблюдалась высокая смертность (как и в опытах Шапошникова), и прошло несколько месяцев, прежде чем все экспериментальные популяции стабилизировались и стали «вполне здоровыми». В «крахмальных» популяциях повысилась частота встречаемости «быстрого» аллеля локуса Amy (альфа-амилазы), изменился также характер амилазной активности в средней кишке. В «мальтозных» популяциях соответствующих изменений не выявлено (Powell, Andelkovič, 1983). Однако было показано, что специфическая адаптация к стрессовым средам произошла как в «крахмальных», так и в «мальтозных» популяциях (Dodd, 1984).

Затем производились эксперименты с целью выявить предпочтения при скрещивании. «Крахмальных» и «мальтозных» мух в течение одного поколения выращивали на одинаковой, стандартной (благоприятной для дрозофил) среде, а потом помещали представителей разных линий в общую камеру и наблюдали, кто с кем предпочитает спариваться. Получены статистически достоверные подтверждения того, что мухи, предки которых в течении нескольких десятков поколений росли на разных средах (предки, но не сами эти мухи!), избегают скрещиваться друг с другом. Мухи с «крахмальной» родословной достоверно предпочитали «крахмальных», «мальтозные» — «мальтозных».

Опыты по выращиванию D. melanogaster в контрастных условиях. Такие же результаты получены при выращивании нескольких популяций D. melanogaster в контрастных условиях («холодно-сухо-темно» и «тепло-влажно-светло»). Здесь тоже изоляция возникла между популяциями, приспособившимися к разным условиям, тогда как между популяциями, независимо друг от друга приспособившимися к одинаковым условиям, изоляция не возникла (Kilias et al., 1980).

Изоляция у дрозофил, обитающих на разных склонах «Каньона Эволюции». Явления, обнаруженные в описанных экспериментах, очевидно, имеет место и в природе. Об этом свидетельствуют результаты изучения дрозофилид, обитающих на разных склонах так называемого «Каньона Эволюции» (Evolution Canyon) на горе Кармел (Израиль). Популяции D. melanogaster, живущие на разных склонах каньона на расстоянии всего 100–400 м. друг от друга (т. е. в нескольких минутах полета) проявляют статистически достоверные предпочтения при скрещивании, избегая спариваний с обитателями другого склона. При этом никаких предпочтений между представителями разных «кланов» (изосамковых линий) с одного и того же склона не наблюдается. Условия на обоих склонах являются для дрозофил стрессовыми и сильно различаются, поскольку склон, обращенный к югу, получает в 6 раз больше солнечного излучения, чем противоположный, обращенный к северу (Korol et al., 2000).

Изоляция у гаммарусов, обитающих на разных субстратах. Аналогичная ситуация наблюдается у представителей разноногих ракообразных — гаммарусов (бокоплавов), у которых подчас разные популяции одного и того же вида обитают на разных субстратах (разных видах водорослей). Эти субстраты в природе могут находиться весьма близко друг от друга, так что рачки в принципе могут свободно переплывать с одних водорослей на другие (однако, по-видимому, предпочитают этого не делать). Представители разных популяций в экспериментах демонстрируют явное предпочтение «своих» при выборе брачного партнера. Проверяют это так: в два тупика Y — образного лабиринта сажают самок, снятых с разных природных субстратов, а в непарный конец лабиринта пускают самца и смотрят, куда он поплывет. Показано, что самцы статистически достоверно предпочитают самок, живших в природе на том же субстрате, что и они сами.

Быстрое развитие изоляции у лососевых рыб. Быстрое возникновение репродуктивной изоляции при расхождении по «экологическим» параметрам характерно отнюдь не только для членистоногих, о которых шла речь выше. Так, показано возникновение частичной репродуктивной изоляции между двумя популяциями нерки (Oncorhynchus nerka), которые начали расходиться от одной предковой линии не ранее, чем в 1937 г. В указанном году нерка была интродуцирована в оз. Вашингтон (штат Вашингтон, США) и вскоре образовала крупную местную популяцию во впадающей в озеро реке (Cedar River). В 1957 г. было обнаружено, что часть особей стала нереститься не в реке, а в озере. В 1992 г. было установлено, что «речные» и «озерные» формы уже представляют собой две частично изолированные популяции, немного отличающиеся морфологически. Некоторые представители «речной» популяции иногда нерестятся в озере, в тех же местах, что и «озерные» формы, однако даже в этом случае скрещивания между представителями разных популяций происходят, по-видимому, значительно реже, чем это диктуется простой вероятностью (Hendry et al., 2000). Репродуктивная изоляция в данном случае развилась самое большее за 56 лет, что соответствует примерно 13 поколениям.

Все эти факты говорят о том, что репродуктивная изоляция, считающаяся одним из главных критериев вида (или даже самым главным), может быстро развиваться под действием отбора как в эксперименте, так и в природных условиях. Возникновение репродуктивной изоляции — ключевой этап видообразования. После того, как между генофондами двух популяций прекратился обмен генами, дальнейшее расхождение (дивергенция) этих популяций становится неизбежной просто в силу статистических факторов. В двух популяциях будут фиксироваться разные мутации, как нейтральные, так и полезные. Рано или поздно это неизбежно приведет к полной генетической несовместимости двух разошедшихся видов. Каждая новая мутация должна быть совместима с остальными генами в генофонде популяции, иначе отбор ее отсеет. Однако мутации, возникающие в одной из популяций, не проверяются отбором на совместимость с генофондом другой популяции. Следовательно, рано или поздно в популяции А закрепится мутация, несовместимая с генофондом популяции Б. В природе на формирование полной генетической несовместимости между двумя изолированными популяциями уходит, как правило, от 2–3 до 10–15 млн лет. Но уже задолго до этого момента разошедшие популяции считаются (и являются) двумя разными видами, потому что реально не скрещиваются в природе, хотя и сохраняют такую возможность.

Промежуточные этапы видообразования

Диаграмма, демонстрирующая варианты скрещивания соседних популяций одного вида. В третьем случае распространение форм может образовать кольцо, в результате две соседние популяции друг с другом не скрещиваются, т. е. формально являются разными видами, хотя и связаны между собой непрерывным рядом взаимно совместимых популяций.


В определении понятия биологического вида существенное значение имеет практически полная репродуктивная изоляция в природных условиях. Если видообразование происходит постепенно, в результате небольших последовательных изменений, то и сегодня мы должны наблюдать все возможные стадии видообразования, а значит и все возможные стадии репродуктивной изоляции: свободное скрещивание между популяциями, затрудненное скрещивание, снижение плодовитости потомства, бесплодное потомство, и наконец — полную генетическую изоляцию. Если ничего подобного среди современных видов обнаружить не удается, то тем самым опровергаются основы эволюционного учения, то есть это пример фальсифицируемости эволюционного учения (см.: Speciation stages).

Существует множество примеров того, как разные виды могут скрещиваться в исключительных условиях. Например, у черной вороны и серой вороны разные ареалы, но на пересечении этих ареалов виды могут образовывать гибриды. Еще один пример — различные виды рыбы рода чукучанов из реки Платт, которые живут рядом, но редко скрещиваются.

Неполное видообразование можно наблюдать у различных кольцевых видов: представители вида обитают вокруг гор, водоемов и т. п., при этом соседние популяции скрещиваются между собой и незначительно различаются, а крайние формы различаются значительно и не скрещиваются (см. диаграмму). Пример кольцевого вида — безлёгочная саламандра Ensatina eschscholtzii, обитающая на склонах гор близ тихоокеанского побережья Северной Америки. В зависимости от района обитания вокруг гор саламандры образуют различные формы, постепенно изменяющие свои морфологические и экологические характеристики. Крайние формы Ensatina eschscholtzii eschscholtzii и Ensatina eschscholtzii klauberi, первая из которых имеет красноватую окраску, а вторая чёрно-белую, сосуществуют в узкой зоне гор на юге Калифорнии, однако между собой не скрещиваются.

Еще один пример — серебристая чайка (Larus argentatus) и клуша (Larus fuscus). Они встречаются в Англии, где их признали разными видами. Но при этом между ними существует цепочка гибридных популяций, идущая вокруг северного полюса. Другие примеры кольцевых видов — зелёная пеночка (Phylloscopus trochiloides), оленья мышь (Реromyscus maniculatus), наземная улитка (Partula olympia), дрозофила Drosophila paulistorum.

У многих гибридов снижена фертильность. У гибридов землероек из рода бурозубок размножение затруднено вследствие разницы хромосомных наборов. Тот же эффект наблюдался в лаборатории при скрещивании Drosophila pseudoobscura из Юты и Калифорнии. Фертильность также снижена у гибридов лягушек из семейства бомбиновых жерлянки краснобрюхой (Bombina bombina) и жерлянки желтобрюхой (Bombina variegata).

Многие другие виды могут давать бесплодное гибридное потомство. В их числе — различные земноводные (например — некоторые виды лягушек из рода Rana) и млекопитающие (например, мул — гибрид от скрещивания лошади и осла — как правило бесплоден). Гибриды гребенчатого тритона и мраморного тритона бесплодны вследствие наличия непарных хромосом.

При скрещивании ряда других видов достигается оплодотворение, но позднее зародыш погибает. В качестве примера можно привести леопардовую лягушку (Rana pipiens) и лесную лягушку (Rana sylvatica) из рода настоящих лягушек. Аналогичная ситуация наблюдается у дрозофил и у некоторых растений, таких как хлопчатник обыкновенный (Gossypium hirsutum) и хлопчатник барбадосский (Gossypium barbadense).

Белый медведь

Конкретным примером крупномасштабных эволюционных изменений является белый медведь (Ursus maritimus), который, несмотря на родство с бурым медведем (Ursus arctos), очевидное в силу того факта, что эти виды могут скрещиваться и давать плодовитое потомство, приобрел значительные физиологические различия с бурым медведем. Эти различия позволяют белому медведю комфортно жить в условиях, в которых бурый медведь бы не выжил. В частности, белый медведь способен проплыть десятки километров в ледяной воде, сливается со снегом и не замерзает в Арктике. Всё это возможно благодаря конкретным изменениям: белая окраска способствует маскировке хищника при охоте на тюленей; полые волоски увеличивают плавучесть и сохраняют тепло; слой подкожного жира, толщина которого к зиме доходит до 10 сантиметров, обеспечивает дополнительную теплоизоляцию; удлиненная по сравнению с другими медведями шея позволяет легче держать голову над водой во время плавания; увеличенные лапы с перепонками действуют как весла; небольшие бугорки и полости-присоски на подошвах уменьшают опасность поскользнуться на льду, а плотная шерсть на подошвах защищает лапы от сильного холода и обеспечивает трение; уши меньше, чем у других медведей, и уменьшают потери тепла; веки действуют как солнечные очки; зубы острее, чем у других медведей, и больше подходят для полностью мясного рациона; увеличенный объем желудка позволяет голодному хищнику съесть сразу целого тюленя, кроме того белый медведь способен обходиться без пищи до девяти месяцев за счет переработки мочевины.

Генетические данные свидетельствуют о том, что белый медведь (вид Ursus maritimus) отделился от североамериканских бурых медведей сравнительно недавно, всего около 150 тыс. лет назад, и очень быстро приспособился к своей новой среде обитания в Арктике. Этот вывод основан, в частности, на результатах анализа ДНК из челюсти ископаемого медведя, жившего 110–130 тыс. лет назад на Шпицбергене. Этот доисторический медведь по структуре своей ДНК оказался переходным между бурыми и белыми медведями (Lindqvist et al., 2009).

2. Эволюционное дерево

Филогенетическое дерево с указанием размера геномов.


Классификация живых организмов представляет собой многоуровневую иерархическую структуру: организмы делятся на царства, царства делятся на типы, типы — на классы, классы — на отряды, и так далее. В результате такого ветвления получается филогенетическое дерево. Наличие единственной (естественной) классификации означает, что существует объективная закономерность в основе этой классификации. Именно такой результат можно ожидать при эволюционном происхождении животных от общего предка. Ветвление филогенетического дерева соответствует делению популяций в процессе видообразования.

Несмотря на многочисленные разногласия между биологами по поводу отнесения тех или иных видов к конкретным группам (таксонам), эти противоречия имеют частный характер. Практика показывает, что биологические классификации, построенные на основе разных признаков (морфологических, эмбриологических, биохимических или генетических) в тенденции стремятся к одной и той же древовидной иерархической схеме — естественной классификации, отражающей последовательность расхождения эволюционных линий. Чем больше признаков учитывается в ходе классификации, тем выше сходство получаемых деревьев. Наличие естественной классификации было очевидно биологам еще в додарвиновские времена, и это изначально трактовалось как свидетельство иерархической организации замысла Творца. Однако в разнообразии других природных объектов, которые, в отличие от живых организмов, не происходят от общего предка, отсутствует единая древовидная иерархическая структура. Классификация таких объектов либо получается принципиально различной при использовании разных наборов признаков (например, минералы), либо имеет принципиально не «древесный» вид (например, химические элементы, звезды). Невозможно объективно построить иерархию элементарных частиц, химических элементов, планет Солнечной системы. Также не существует объективной иерархии таких сознательно созданных объектов, как книги в библиотеке, дома, мебель, машины и т. д… Можно при желании объединять эти объекты в произвольные иерархии, но нет единственной объективной иерархии, принципиально лучшей, чем все остальные.

Если бы была верна концепция «бараминов», естественная классификация и филогенетические деревья, получаемые на основе различных признаков и статистических методов, должны были бы иметь весьма характерный вид: изолированные пучки коротких ветвей (барамины) должны были бы отделяться друг от друга очень длинными (точнее, имеющими абсолютно произвольную длину) ветвями. Этого не наблюдается. Длины ветвей филогенетического дерева (отражающие, в первом приближении, степень различий по используемым признакам) в среднем примерно одинаковы между видами одного рода, родами одного семейства, семействами одного отряда и т. д. Это обстоятельство является дополнительным свидетельством в пользу того, что между процессами появления новых видов, родов, семейств, отрядов, классов, типов и т. д. не существует принципиальной разницы. Каждый новый род изначально появляется «всего лишь» как новый вид, и лишь позже, в ретроспективе, может «заслужить» в глазах биологов статус рода.

Кроме того, если бы в идее «бараминов» было хоть какое-то рациональное зерно, этого не могли бы не заметить специалисты по систематике животных и растений еще задолго до Дарвина. Они бы обязательно увидели, что один из надвидовых таксономических рангов (род, отряд или семейство — антиэволюционисты обычно утверждают, что их «барамины» соответствуют каким-то из этих рангов) радикально отличается от всех остальных. Например, они бы увидели, что животный мир четко делится на семейства, которые поэтому являются особым, «естественным» уровнем классификации (и соответствуют «богосотворенным родам»), и гораздо менее четко делится на роды, подсемейства, надсемейства, отряды, подклассы и т. д., которые никаким «богосотворенным родам» не соответствуют. В действительности все ранги биологической классификации имеют примерно одинаковую степень как «четкости», так и «расплывчатости». По-настоящему «естественной» единицей классификации безоговорочно признается лишь вид (по критерию полного или почти полного отсутствия скрещиваний с другими видами в природе), но барамин по определению — это не вид, а нечто большее. Однако никакого надвидового ранга, более «естественного», чем остальные, в природе не существует.

Существуют различные статистические методы для точной оценки того, насколько объекты с разными свойствами укладываются в ту или иную иерархию. Эти методы измеряют так называемый «филогенетический сигнал», позволяя отличить мнимые закономерности от объективных. Например, у любого «генеалогического древа» автомобилей будет низкий уровень филогенетического сигнала. У эволюционного дерева и у различных его частей, напротив, стабильно четкий филогенетический сигнал.

Есть несколько источников данных, на основе которых можно делать выводы о степени родства между видами. Если существует единое эволюционное дерево, объединяющее все виды в объективную генеалогию, то все данные должны подтверждать эту генеалогию. Филогенетические деревья, построенные независимо, должны соответствовать друг другу. Наиболее простой, хотя и не очень точный способ построить такое дерево — сравнение строения организмов животных: чем меньше различий между видами, тем меньше поколений отделяют их от общего предка. Палеонтологическая летопись, наряду с другими подходами, позволяет установить родство между классами животных. Например, найденные останки пернатых динозавров свидетельствуют о родстве между рептилиями и птицами. Биогеография и эмбриология также дают информацию об эволюционной близости видов. Наиболее точный источник данных, недоступный во времена Дарвина — сравнительный анализ геномов различных организмов. Эволюционное дерево можно построить по каждому отдельно взятому гену, также исследователи рассматривают всевозможные некодирующие последовательности. Практика показывает, что чем больше генов включается в анализ, тем меньше остается в дереве статистически слабо обоснованных участков, и тем меньше различия между деревьями, построенными по разным наборам генов.

Все эти источники информации дают одинаковую картину с точностью до погрешности используемых методов. Тот факт, что эволюционные деревья, построенные по разным данным, соответствуют друг другу, элементарно объясняется эволюционной теорией. Другие объяснения отсутствуют: например, нет никаких причин, почему организмы, сходные по строению, должны иметь сходные некодирующие последовательности в геноме (интроны в одних и тех же местах генов, остатки встроившихся ретровирусов в одних и тех же местах генома и т. д.), если они не произошли от одного предка.

Примеры биологических исследований, связанных с построением эволюционных деревьев:

1) Новые данные позволили уточнить родословную животного царства

2) Невероятное разнообразие жуков получило эволюционное объяснение

3) Геном ланцетника помог раскрыть секрет эволюционного успеха позвоночных

4) Найдено «недостающее звено» между членистоногими и загадочными кембрийскими чудовищами аномалокарисами

5) Доказан скачкообразный характер эволюционного процесса

Горизонтальный перенос генов, межвидовая гибридизация и симбиогенез порождают горизонтальные перемычки между некоторыми ветвями эволюционного дерева, особенно в его «нижней» части — у прокариот. Это, однако, не разрушает его общую древовидную (иерархическую) структуру, потому что вертикальная передача генов (от родителей к потомкам) у всех живых организмов резко преобладает над горизонтальной.


Лингвистическая эволюция как аналог биологической

Эволюция языков отчасти похожа на эволюцию биологических видов, хотя это сходство не следует преувеличивать. Лингвистическая эволюция в основном нейтральна, т. е. не имеет приспособительного характера (нельзя утверждать, например, что грамматика чукотского языка более приспособлена к холодному климату, чем грамматика африканских языков). В биологической эволюции, впрочем, тоже велик элемент нейтральности. Построение эволюционных деревьев в биологии осуществляется чаще всего на основе именно нейтральных признаков (потому что приспособительные признаки — менее надежное свидетельство родства; они часто могут возникать у неродственных форм в сходных условиях в результате одинаковой направленности отбора). Специалисты по исторической лингвистике активно и весьма успешно используют математические методы построения эволюционных деревьев, разработанные биологами (подробнее см. в заметке Лингвистическая эволюция сходна с биологической).

Аналогия с эволюцией языков полезна нам прежде всего потому, что она помогает лучше понять два ключевых свойства биологической эволюции: ее постепенность и относительную дискретность видов.

Постепенность. Языки, как и биологические виды, эволюционируют путем накопления мелких изменений. Один язык (например, латынь) превращается в другой (например, итальянский) не сразу, а постепенно. Каждое следующее поколение говорит лишь немного иначе, чем предыдущее. Не бывает так, чтобы родители, говорящие, к примеру, на латыни, родили детей, которые, научившись говорить, вдруг заговорили по-итальянски. Так же и в эволюции видов: родители одного вида не могут родить детенышей, относящихся уже к другому виду. Переход между видами во времени происходит плавно и незаметно; резкие различия проявляются, только если сравнивать между собой конечные звенья длинной цепи постепенных изменений.

Дискретность видов. Несмотря на множество наблюдаемых в природе случаев плавных переходов между видами, разнообразных гибридных зон, кольцевых видов и т. п. (см. в разделе «Наблюдаемая эволюция«), большинство существующих видов все-таки достаточно дискретны, т. е. имеют довольно четкие границы. Обычно мы можем однозначно определить видовую принадлежность животного или растения. Между большинством видов есть заметные «разрывы» (хиатусы) в пространстве признаков. Антиэволюционисты иногда ставят это в упрек эволюционному учению, утверждая, что если бы эволюция действительно происходила, мы не должны были бы наблюдать никакой дискретности в видовом разнообразии, а только сплошные плавные переходы.

Наблюдаемая дискретность видов во многом определяется дискретностью экологических условий и пониженной приспособленностью промежуточных форм. Например, в тайге условия одни, среди арктических льдов — другие, к первым условиям лучше приспособлен бурый медведь, ко вторым — белый. Промежуточные формы в обоих биотопах будут проигрывать в конкурентной борьбе живущим там специалистам. О таком механизме формирования дискретности, основанном на пониженной конкурентоспособности промежуточных форм, писал еще Дарвин. Дополнительное объяснение дискретности можно получить из аналогии с языками.

Языки тоже в основном дискретны. Конечно, в зонах смешения разноязычных народов иногда формируются гибридные диалекты (аналог гибридных зон в биологии), но все-таки это не типично. Большинство людей говорит на вполне определенном языке, а не на каких-то смешанных диалектах. Главная причина дискретности в биологии и лингвистике, по-видимому, одна и та же. Человеку выгодно уметь свободно и полноценно обмениваться информацией с достаточно большой популяцией себе подобных. Говорить на смеси русского и немецкого очень неудобно: плохо будут понимать и русские, и немцы. Живым организмам точно так же выгодно уметь свободно и полноценно обмениваться генами (смешивая их в потомстве) с достаточно многочисленной группой особей. В пределах каждого генофонда гены под действием отбора становятся «притертыми», приспособленными друг к другу. Иметь в своем геноме смесь генов, приспособленных к разным генофондам, в общем случае невыгодно, потому что потомство такого организма от скрещивания с любой из «чистых» форм, скорее всего, будет иметь пониженную жизнеспособность. Необходимость (выгодность) свободного обмена информацией (словесной или генетической) в пределах достаточно больших популяций в тенденции приводит к формрованию и поддержанию наблюдаемой дискретности. В природных условиях довольно часто возникают межвидовые гибриды, но число их, как правило, остается небольшим, а их потомство в будущем может постепенно распасться на практически «чистых» представителей двух исходных видов. Попадая в генофонд вида А, смешанный набор генов гибридной особи будет под действием отбора постепенно очищен от «посторонних примесей», так что в итоге в генофонде останутся только гены, хорошо «приспособленные» именно к этому генофонду. То же самое произойдет и с теми генами гибрида, которые будут подвергаться отбору в пределах генофонда Б. Именно поэтому межвидовая гибридизация, как правило, не приводит к слиянию двух разошедшихся видов в один.

3. Палеонтологические доказательства

Ископаемая летопись

Как правило, останки растений и животных разлагаются и исчезают без следа. Но иногда биологические ткани замещаются минеральными веществами, и образуются окаменелости. О том, как и при каких обстоятельствах это происходит, и почему иногда в древних остатках живых организмов могут сохраняться даже отдельные органические молекулы и тонкие структуры, такие как клетки или кровеносные сосуды, подробно рассказано в статье одного из авторов данной публикации, палеонтолога А.Ю.Журавлева «Вечно неживые«.

Обычно учёные получают в распоряжение окаменевшие кости или раковины, то есть твёрдые части, скелеты. Иногда находят отпечатки следов животных или следы их жизнедеятельности. Еще реже находят животное целиком — вмороженным в лёд в районах современной вечной мерзлоты, попавшим в смолу древних растений (янтарь) или в другую естественную смолу — асфальт (см.: изображения окаменелостей).

1850

1950

2002

Прогресс в изучении эволюции человека. Увеличение числа известных науке видов гоминин по времени. Каждый вид изображен в виде прямоугольника, показывающего границы, в которых варьировал объём черепа, и место вида в палеонтологической летописи. Видно постепенное заполнение промежутков между видами.


Изучением ископаемых останков занимается палеонтология. Как правило, осадочные породы залегают слоями, поэтому более глубокие слои рассказывают более старые истории (принцип суперпозиции). Этот принцип лег в основу стратиграфии — «науки о земных слоях». Данные стратиграфии позволяют определять относительный возраст окаменелостей, то есть выяснять, какие ископаемые организмы жили раньше, а какие позже. Любопытно, что автор принципа суперпозиции, датский ученый XVII века Николай Стенон (Нильс Стенсен) за свои заслуги перед церковью был в 1987 году беатифицирован (причислен к лику блаженных) римским папой Иоанном Павлом II. Возможно, это единственный случай, когда католический блаженный внес столь важный вклад в развитие эволюционизма.

Принцип суперпозиции Стенона и основанная на нем наука стратиграфия позволяют, сравнивая ископаемые формы из последовательных напластований, делать выводы об основных направлениях эволюции. Для оценки возраста окаменелостей используются многочисленные методы датировки, которые подразделяются на относительные (стратиграфические) и абсолютные (разнообразные радиометрические методы, а также люминисцентные, методы электронно-парамагнитного резонанса и др.) (см. А.Марков. Хронология далекого прошлого). Надежность современных методов датировки земных слоев и содержащихся в них ископаемых доказывается, в частности, тем обстоятельством, что оценки возраста, полученные при помощи множества независимых методов, как правило, получаются сходными. Все эти методы быстро развиваются. Еще лет 20–30 назад довольно часто наблюдались значительные расхождения результатов, полученных разными методами. На этих расхождениях до сих пор любят спекулировать противники эволюции, но их сведения сильно устарели. По мере совершенствования используемых методов они становятся все более точными и дают все более сходные результаты. Поэтому, например, международная геохронологическая шкала образца 1980-х годов довольно заметно отличается по абсолютным датировкам от шкалы образца 2000-х годов (различия в некоторых датах, например, в дате начала кембрийского периода, могут достигать 5–7 %), однако за последние 10 лет изменения такого рода практически перестали происходить. На сегодняшний день абсолютный возраст древних отложений во многих случаях удается определить с точностью до долей процента. О достоверности радиометрических методов и несостоятельности попыток антиэволюционистов их «опровергнуть» см.: Николай Борисов. Проставляем даты на геологической летописи, или Как физики геологам помогают; А.Марков. Хронология далекого прошлого.

При взгляде на палеонтологическую летопись бросается в глаза тот факт, что жизнь на Земле существенно менялась, вплоть до полной неузнаваемости. Чем глубже в прошлое мы смотрим, тем меньше видим общего с современной биосферой. Первые прокариоты (простейшие одноклеточные, не обладающие оформленным клеточным ядром) появляются приблизительно 3.5 млрд лет назад. Первые одноклеточные эукариоты появляются 1.75 млрд лет назад (подробнее см.: Происхождение эукариот). Еще через миллиард лет, немногим более 635 млн лет назад, в палеонтологической летописи появляются первые бесспорные многоклеточные животные — губки (см.: Животные появились свыше 635 миллионов лет назад). Через несколько десятков млн лет мы находим первых червей и моллюсков, а еще через 15 млн лет — первых примитивных позвоночных, похожих на современных миног. Челюстноротые рыбы появляются 410 млн лет назад, насекомые — 400 млн лет назад, и еще 100 млн лет суша покрыта в основном папоротниками и населена насекомыми и земноводными. С 230 по 65 млн лет назад на Земле господствуют динозавры, самые распространенные растения — саговники и другие группы голосеменных. Первые цветковые растения появляются чуть более 100 млн лет назад. В целом чем ближе к современности, тем больше сходства имеют ископаемые флоры и фауны с современными. Наблюдаемая картина соответствует эволюционной теории и не имеет других научных объяснений.

«ГЕОЛОГИЯ ПОТОПА». Антиэволюционисты, как правило, отрицают геохронологическую шкалу и утверждают, что практически все осадочные породы сформировались единовременно во время Всемирного Потопа. При этом погибшие организмы отсортировались таким образом, что в нижних слоях осадков оказались самые маленькие и простые организмы, в верхних — крупные и сложные. «Геология потопа» имеет целый ряд проверяемых следствий, ни одно из которых не подтверждается фактами. Вот несколько примеров таких неподтвержденных следствий: 1) Слои осадочных пород должны располагаться всегда горизонтально (антиэволюционисты обычно отрицают тектонику и складчатость, из-за которых слои часто залегают не горизонтально); 2) На дне океанов должны быть широко представлены самые нижние (докембрийские, палеозойские) осадочные слои (их там нет совсем, потому что дно океанов постоянно обновляется в результате тектонических процессов); 3) Должно быть много районов, которые в течение всего Потопа находились под водой, и где поэтому должна была образоваться полная стратиграфическая колонна — все слои от архея до голоцена (таких полных геологических разрезов не существует, потому что ни в одной точке Земли не поддерживались благоприятные для осадконакопления условия непрерывно в течение всей земной истории); 4) Не должно быть на большой высоте над уровнем моря стационарных комплексов окаменелостей, таких как ископаемые коралловые рифы; не должно быть высоких гор, сложенных в основном осадочными породами; 5) Гидродинамическая «сортировка» ископаемых во время Потопа могла быть только статистической, но не абсолютной. Иными словами, мы должны были бы находить мало костей млекопитающих в докембрийских отложениях, но мы не находим их совсем, а этого «Геология потопа» объяснить не может. Одна-единственная достоверная находка ископаемого кролика в докембрии опрокинула бы современную эволюционную теорию, и научный прогноз состоит в том, что такая находка никогда не будет сделана.

«ЭКОЛОГИЧЕСКАЯ СОРТИРОВКА». Еще один хитроумный зигзаг антиэволюционной мысли породил «теорию», согласно которой «сортировка» ископаемых во время Потопа объясняется тем, что разные животные с разной эффективностью «спасались» от бедствия: низшие формы погибли первыми, тогда как высшие продержались дольше — например, потому, что были способны убежать в горы. Что касается растений, не способных куда-либо убежать, то их закономерное распределение в земных слоях противники эволюции объясняют, видимо, тем, что низшие растения росли ниже, а высшие — выше над уровнем моря (картина, имеющая мало общего с реальностью). Эта «теория» еще смехотворнее и беспомощнее, чем «модель гидродинамической сортировки». Она рассчитана исключительно на людей, абсолютно не знакомых с реальными данными стратиграфии и палеонтологии. Например, как объяснить с точки зрения этой теории, что и пыльца и споры наземных растений в осадочных породах тоже распределяются в соответствии с общим правилом? В докембрийских и кембрийских отложениях вообще нет пыльцы и спор наземных растений. Первые споры наземных мохообразных появляются в отложениях середины ордовикского периода (около 465 млн лет назад). Споры первых сосудистых растений известны с конца ордовика (450–444 млн лет назад) (см.: Палеонтологи уточнили время и место появления сосудистых растений). И так далее, вплоть до появления пыльцы цветковых растений (и самих окаменевших цветковых растений) в меловом периоде (немногим более 100 млн лет назад). Прекрасно известно, что пыльца и споры наземных растений далеко разносятся ветром, тонут в морях и поэтому повсеместно присутствуют в морских отложениях, образующихся в наши дни. Так же обстояло дело и в прошлом. Поэтому «споро-пыльцевой» анализ — один из надежнейших методов биостратиграфии, позволяющий с большой точностью определять возраст любых осадочных отложений, как морских, так и континентальных. «Теория экологической сортировки» не в состоянии объяснить стратиграфическое распространение пыльцы и спор. То же самое со всей очевидностью относится к таким категориям ископаемых, как: 1) окаменевшие следы (ихнофоссилии), оставленные древними организмами на морском дне и на мягкой почве континентов, 2) морской планктон (радиолярии, фораминиферы, кокколитофориды и т. д.) — какая у них-то могла быть экологическая сортировка? 3) древние озерные отложения; хороший пример — отложения юрского озера Каратау, где есть разнообразные остатки юрских позвоночных (в т. ч. мелких птерозавров), насекомых, растений, но нет ни морских организмов, ни окаменелостей, принадлежащих животным и растениям других эпох. Причем тут всемирный Потоп? Объяснить всю совокупность палеонтолого-биостратиграфических данных всемирным Потопом абсолютно немыслимо, если иметь об этих данных сколько-нибудь полное представление.

КАТАСТРОФИЗМ. На ранних этапах развития исторической геологии и палеонтологии, когда было выделено еще очень небольшое число геохронологических интервалов, наблюдаемую картину пытались объяснить при помощи теории катастроф (Бог несколько раз уничтожал свое Творение глобальными катастрофами, а потом творил заново). Но сегодня глобальные (узнаваемые по всему миру) геохронологические интервалы, каждый со своим уникальным комплексом окаменелостей, уже исчисляются сотнями, а преобразования животного и растительного мира в последовательностях слоев явно выглядят во многих случаях вполне постепенными. Даже самые ярые антиэволюционисты не могут вообразить, зачем могло понадобиться Богу сотни раз уничтожать жизнь, а потом каждый раз воссоздавать ее лишь в слегка измененном виде. Развитие исторической геологии и палеонтологии, таким образом, опровергло катастрофизм. Тем не менее в истории Земли действительно были периоды массовых вымираний, сыгравшие значительную роль в эволюции биосферы (см.: Экологические кризисы, их причины и эволюционная роль).

Биостратиграфия

Как и во многих других случаях, для того, чтобы получить верное представление о степени убедительности палеонтологических доказательств эволюции, необходимо прежде всего осознать масштаб происходящего, всю громадность объема накопленных данных. Для начала рассмотрим современную геохронологическую шкалу — результат многолетних трудов многотысячной международной армии геологов (См. также: Стратиграфия и геохронология).

{Ссылка на более крупное ищображение: http://evolbiol.ru/evidence05_files/eviden1.jpg}

На этой шкале выделено 115 временных (геохронологических) интервалов. Это «международные» интервалы, то есть такие, которые удается опознать по всему миру. В каждом регионе существуют еще и местные (региональные) стратиграфические шкалы, которые, как правило, намного более детальны. Однако многие региональные слои не удается точно соотнести («скоррелировать», как говорят геологи) со слоями, известными в других регионах. Поэтому общее количество выделяемых слоев на международной шкале значительно меньше, чем на региональных шкалах. Почему же не все региональные слои удается скоррелировать? Дело в том, что корреляция слоев в большинстве случаев осуществляется по комплексам окаменелостей. А в разных регионах во все времена, как и сегодня, жили разные организмы. Для межрегиональной корреляции удобнее всего использовать такие ископаемые организмы, которые: 1) были распространены всесветно (такие организмы называют «космополитами»), 2) были достаточно многочисленными и неплохо сохраняющимися в ископаемом состоянии (для этого весьма желательно наличие скелета), 3) существовали недолго (иначе они будут встречаться во многих слоях, и их нельзя будет использовать для идентификации конкретного слоя). Ископаемые организмы, удовлетворяющие этим условиям, называют «руководящими ископаемыми», и они играют ключевую роль в стратиграфии. Как правило, роль руководящих форм играют группы организмов, для которых была характерна наиболее быстрая эволюция, быстрая смена видового состава. Как видим, стратиграфия — это наука, в которой геология теснейшим образом переплелась с эволюционным учением. Очень хорошими руководящими ископаемыми являются споры и пыльца растений, а также разнообразные мелкие планктонные организмы (например, фораминиферы, радиолярии, диатомовые водоросли, кокколитофориды), а во многих случаях и более крупные животные (трилобиты, аммониты, конодонты, археоциаты, двустворчатые и брюхоногие моллюски, брахиоподы и мн. др.). Каждый интервал геохронологической шкалы, кроме докембрийских (показаны на рисунке справа), характеризуется уникальным комплексом руководящих ископаемых, а также гораздо более обширным комплексом всех прочих ископаемых, по которым коррелировать слои тоже можно, но не так удобно. В докембрии ископаемых мало, и поэтому там стратиграфия базируется в основном на радиометрическом датировании (определении абсолютного возраста) горных пород. В настоящее время уже установилось практически полное согласие между палеонтологическими (основанными на эволюции организмов) и физическими (радиометрическими) методами геологической корреляции. Таким образом, налицо союз трех наук: геологии, эволюционной биологии и физики. Все вместе они дают стройную и непротиворечивую картину постепенного развития жизни на нашей планете.

Креационисты иногда заявляют, что они отрицают из всех наук только одну-единственную — эволюционную биологию, а со всеми остальными науками у них полное согласие. Неправда. Отрицая геохронологическую шкалу, креационисты идут сразу против трех наук: биологии, геологии и физики.

Фрагмент стратотипа (эталонного, или типового геологического разреза) отложений тоарского века (это последний век ранней юры, начавшийся 183 млн лет назад и закончившийся 175,6 млн лет назад; его можно найти на приведенной выше международной шкале — Toarcian). Стратотип находится во Франции, но отложения тоарского века известны по всему миру. Решения о том, какой разрез считать типовым, принимает Международная стратиграфическая комиссия. Быстрая эволюция аммонитов в тоарском веке (их изображения можно видеть на пронумерованных табличках) позволяет подразделить тоарские отложения на множество последовательных «зон» — геохронологических интервалов гораздо меньшей длительности чем «век» (геологические века длились по несколько миллионов лет). Никакая «сортировка» ископаемых во время Потопа — ни гидродинамическая, ни экологическая — не могла бы обеспечить присутствие каждого из руководящих видов аммонитов (морских активно плавающих животных) только в одном узком слое осадков, прослеживающихся на большой территории. Особенно если учесть, что эти виды были очень сходны и по размеру, и по экологии, и по строению, так что различить их может только специалист. Эти виды, несомненно, сменяли друг друга в геологическом времени, а осадки накапливались в течение весьма длительного срока.

Отложения датского века (Danian), первого века кайнозойской эры, — в данном случае это темный известняк — залегают поверх ярко-белых меловых отложений маастрихтского века (Maastrichtian), последнего века мезозойской эры. Граница белых и темных слоев соответствует рубежу мезозоя и кайнозоя (65,5 млн лет), когда вымерли последние динозавры, аммониты и многие другие животные. Ископаемые фауны белого и темного слоев различаются очень сильно (потому что на этом рубеже произошло массовое вымирание), и так по всему миру (этот снимок сделан в Дании).

«Золотой гвоздь», вбитый в границу отложений криогенового и эдиакарского (вендского) периодов в типовом разрезе в Австралии. Возраст этой границы — около 635 млн лет. Ниже этой границы, в криогеновых отложениях, по всему миру присутствуют недвусмысленные следы величайшего в истории Земли оледенения (ледники доходили до экватора, Земля в том время едва не превратилась в «снежок», см. Snowball Earth). В криогеновых отложениях обнаружены химические следы присутствия низших многоклеточных животных — губок (см.: Животные появились свыше 635 миллионов лет назад), более сложные животные не найдены. Выше этой границы, в эдиакарском периоде, появляются ископаемые эмбрионы многоклеточных, заключенные в сложные оболочки, и другие формы животной жизни (см.: Тайна эмбрионов Доушаньтуо раскрыта; Малаховская, Иванцов. Вендские жители земли). Дырки, высверленные около «золотого гвоздя», остались после взятия проб для палеомагнитного анализа (этот метод позволяет определить, на какой географической широте находился данный район в то время, когда образовывались эти слои).

Геологическая карта мира (источник: OneGeology). На геологических картах разными цветами обозначается возраст отложений, залегающих на поверхности (точнее, непосредственно под слоем четвертичных, то есть самых молодых отложений). На этой карте используются такие же цвета, как на глобальной геохронологической шкале, приведенной выше. Обратите внимание на то, как выглядит на геологической карте Атлантический океан (для океанского дна показан возраст базальтового основания, без учета накопившихся сверху более молодых осадочных пород). Возраст океанского дна наглядно свидетельствует об истории океана. Новое океанское дно формируется в районе Центрально-Атлантического хребта и «расползается» на запад и восток. Чем дальше от хребта, тем древнее породы. Самые старые участки дна океана, у берегов Африки и Америки, окрашены зеленым, кое-где голубым цветом, что соответствует меловому и юрскому возрасту. Именно тогда и начал образовываться Атлантический океан (см.: тектоника). Америка и Старый Свет расползаются в разные стороны примерно с такой же скоростью, с какой у человека растут ногти. Самое замечательное, что сегодня мы уже можем непосредственно наблюдать это движение и измерять его скорость (при помощи высокочувствительной аппаратуры, установленной на спутниках). Антиэволюционисты, верящие в молодой возраст Земли и не верящие в точность радиометрического датирования, все равно не в состоянии объяснить, почему результаты этого датирования оказались именно такими.

Биостратиграфия — наука весьма практическая, она играет ключевую роль в поиске полезных ископаемых. Если бы она была основана на ложных посылках, как утверждают антиэволюционисты, не стали бы нефтяные компании — организации, весьма далекие от предрассудков — платить большие деньги биостратиграфам, которых они всегда нанимают для разведки новых месторождений.

По имеющимся оценкам, более 99 % видов живых существ, когда-либо существовавших на Земле, — это вымершие виды, не дожившие до наших дней. На сегодняшний день палеонтологи описали примерно 250000 ископаемых видов, каждый из которых имеет строго определенное стратиграфическое распространение, то есть встречается только в одном слое или в нескольких соседних слоях — и нигде больше. Средняя продолжительность существования вида, судя по палеонтологическим данным — порядка 2–3 млн лет (некоторые виды существовали значительно дольше, другие — значительно меньше). Число описанных ископаемых родов — где-то около 60000; семейств — примерно 7000. Каждый род и каждое семейство тоже имеет строго определенное стратиграфическое распространение. Роды существуют десятки миллионов лет, семейства — многие десятки или сотни миллионов лет (это средние, ориентировочные цифры). Между прочим, анализ палеонтологической летописи показывает, что средняя продолжительность существования родов и семейств живых организмов неуклонно росла по крайней мере в течение последних 550 млн лет. Эволюционное учение прекрасно объясняет этот факт: в биосфере постепенно накапливаются наиболее устойчивые, «выносливые» группы организмов, которые легче переносят изменения среды и поэтому вымирают реже. Как это объяснить с креационистских позиций, пусть придумывают сами креационисты. Наиболее интересные количественные закономерности эволюции, выявленные путем анализа палеонтологической летописи, рассмотрены в нашем специальном обзоре.

Стратиграфическое распространение каждой отдельной группы организмов (и всех их вместе) подтверждает эволюцию и может быть адекватно объяснено только с эволюционных позиций. В частности, практически в каждой группе ископаемых прослеживаются превосходные «эволюционные ряды»: постепенные изменения строения организмов, сменяющих друг друга во времени. Довольно часто эти изменения выглядят направленными, в других случаях можно наблюдать более-менее случайные колебания. Есть ряды, в которых эти изменения невелики и ограничиваются появлением новых разновидностей или видов, а есть ряды, в которых можно наблюдать появление новых родов, семейств и более крупных таксонов. Примеры «макро-рядов» приведены ниже, а здесь приведем пример «микро-ряда».

Последовательная смена восьми видов неправильных морских ежей рода Micraster в отложениях верхнего турона — верхнего кампана (ок. 90–70 млн лет назад). Это пример последовательности небольших изменений, от которых антиэволюционисты обычно отмахиваются со словами «ну и что, еж остался ежом». Конечно, остался, ведь новые классы животных возникают крайне редко (морские ежи — это таксон ранга класса). Но здесь, тем не менее, мы видим последовательную смену восьми разных видов. Некоторые изменения морфологии в этом ряду выглядят ненаправленными, другие — вполне направленными (например, наблюдается неуклонное смещение рта все ближе к переднему краю панциря). Данный эволюционный ряд был связан с приспособлением микрастеров к жизни во все более тонкозернистом грунте (это зарывающиеся животные, питающиеся грунтом). Микрастеры вымерли 65,5 млн лет назад вместе с динозаврами, а вскоре после этого вымерли и другие роды этого семейства (Micrasteridae). Отряд, к которому относится это семейство (Spatangoida), дожил до наших дней, но он сегодня представлен уже другими семействами.

Читатели могут сами оценить масштаб накопленных палеонтологами сведений, ознакомившись с глобальными палеонтологическими базами данных, которые можно скачать здесь. Это колоссальный объем информации, от которого нельзя отмахнуться. Все эти сведения прекрасно согласуются с эволюционным учением и не имеют других научных объяснений.

Профессионально заниматься биостратиграфией и палеонтологией и при этом быть антиэволюционистом — немыслимо. Это все равно что быть хирургом, полагая, что в артериях течет воздух. При этом среди палеонтологов много верующих — возможно, даже больше, чем среди представителей других биологических специальностей. Многие палеонтологи склонны видеть в постепенном и закономерном развитии жизни Божий промысел.

Почему же некоторые выдающиеся палеонтологи прошлого, такие как Жорж Кювье, не признавали эволюцию? Ответ очень прост: потому что в те времена палеонтология находилась еще в зародышевом состоянии. Если бы современные палеонтологи знали о геологии, биологии, стратиграфии и палеонтологии только то, что было известно Кювье и его современникам, они тоже, вероятно, смогли бы обойтись без эволюционного учения. А вот если бы Кювье жил и работал в наше время, он бы непременно был эволюционистом.

Переходные формы

Общеизвестное доказательство эволюции — наличие так называемых промежуточных форм (переходных форм), то есть организмов, сочетающих в себе характерные признаки разных видов (или разных таксонов более высокого ранга — родов, семейств и т. д.). Как правило, говоря о промежуточных (или переходных) формах имеют ввиду ископаемые виды, хотя промежуточные виды вовсе не должны непременно вымирать. На основе филогенетического дерева теория эволюции предсказывает, какие промежуточные формы реально существовали (и поэтому могут быть найдены), а какие — нет. В соответствии с научным методом, сбывшиеся предсказания подтверждают теорию. Например, зная строение организмов пресмыкающихся и птиц, можно предсказать некоторые особенности переходной формы между ними. Мы прогнозируем возможность найти останки животных, подобных рептилиям, но с перьями, или останки животных, подобных птицам, но с зубами или с длинными хвостами. При этом мы предсказываем, что не будут найдены переходные формы между птицами и млекопитающими, например — ископаемые млекопитающие с перьями или подобные птицам ископаемые с костями среднего уха как у млекопитающих.

Вскоре после публикации «Происхождения видов» был обнаружен первый скелет археоптерикса — промежуточной формы между рептилиями и птицами. У археоптерикса было развито оперение (типичная птичья черта), а по строению скелета он слабо отличался от динозавров. У него были когти на передних конечностях, зубы и длинный костяной хвост, а характерных «птичьих» особенностей скелета было немного (крючковидные отростки на ребрах, вилочка). Позднее были найдены и другие переходные формы между рептилиями и птицами.

Антиэволюционисты, как правило, имеют крайне превратные представления о том, что должны представлять из себя обнаруживаемые в ископаемой летописи переходные формы. Например, они «требуют», чтобы переходная форма между А и Б была непременно промежуточной между А и Б по всем без исключения признакам. Если какие-то признаки переходной формы ближе к А, а другие — к Б, антиэволюционисты объявляют такую форму «не переходной, а просто мозаичной». Тем самым антиэволюционисты навязывают эволюционной теории такие проверяемые следствия, которые из нее вовсе не следуют. Эволюционная теория не утверждает, что все признаки организмов эволюционируют с абсолютно одинаковой скоростью. Неравномерность темпов эволюции — одно из общих мест современной эволюционной теории. Естественно, в ходе эволюционного перехода от А к Б одни признаки А становятся «как у Б» раньше, другие — позже. Нет никаких причин, почему бы это должно было быть не так. Иными словами, эволюционная теория как раз и предсказывает, что большинство переходных форм должны быть «мозаичными».

Другой часто встречающийся тип неправомерных «требований» антиэволюционистов строится по схеме: «По-вашему утки произошли от крокодилов, ну так предъявите нам крокоутку». Но современные утки не произошли от современных крокодилов. И те, и другие, произошли от общего предка, который жил давно (по-видимому, в пермском периоде, более 250 млн лет назад) и не был ни крокодилом, ни уткой. Он был, если уж на то пошло, древним примитивным архозавром. И от него произошли не только утки и крокодилы, но и все динозавры, а уже затем от динозавров произошли птицы. Общий предок есть у любых двух современных организмов, но этот предок, естественно, не является ни одним из них. Поэтому мы не можем и не должны никому предъявлять крокоуток. Однако, поскольку птицы реально произошли от динозавров, мы имеем возможность предъявить целый ряд самых настоящих птицединозавров (см. ниже).

Еще один способ борьбы антиэволюционистов с переходными формами — это «игра в слова». «Эта форма ближе к А? Значит это просто А. Ближе к Б? Ну тогда это просто Б». Такой эссенциализм поддерживается формальными правилами биологической классификации. Биологи, согласно этим правилам, не могут написать на этикетке «форма, переходная между видом А и видом Б». Максимум, что они могут сделать, это выделить переходную форму в отдельный вид, назвать его, скажем, А1, и подписать внизу мелкими буквами «вид, переходный между А и Б». Но антиэволюционисты не замечают этих приписок и говорят: «Какая же это переходная форма? Это просто вид А1».

Еще один тип антиэволюционистских передергиваний — требование доказать, что данная переходная между А и Б форма действительно является прямым предком Б. Это все равно что требовать строгих доказательств того, что найденный в Африке череп Омо I (см: 195 000 лет назад в Эфиопии жили «анатомически современные» люди) принадлежит самой Митохондриальной Еве, а не ее сестре или более дальней родственнице. Шансы найти в очень неполной палеонтологической летописи чьего-либо прямого предка очень малы, но даже когда таких предков находят, нет способов доказать, что это именно прямой предок, а не его близкий родственник. Реально находимые переходные формы являются формами, близкородственными искомому прямому предку (или его мало изменившимися потомками), требовать большего — значит опять-таки приписывать эволюционной теории не следующие из нее «следствия».

Превращение динозавров в птиц («орнитизация динозавров-теропод»)

Серия блестящих палеонтологических находок, сделанных в последние годы, пролила свет на многие детали эволюционного превращения динозавров в птиц. Как выяснилось, многие хищные динозавры-тероподы в течение юрского и мелового периодов эволюционировали «в птичью сторону». Только одна из этих эволюционных линий дала начало современным птицам и не вымерла 65,5 млн лет назад вместе с остальными динозаврами.

Ниже приведены краткие обзоры нескольких недавних исследований (чтобы узнать подробности, воспользуйтесь гиперссылками):

1) Перья сначала служили для красоты, а для полета пригодились позже. В 2008 году был найден пушистый нелетающий «птицединозаврик» с четырьмя очень длинными перьями на хвосте, как у современных райских птиц. Исследователи полагают, что длинные хвостовые перья служили исключительно «для красоты», то есть для привлечения брачного партнера. Самцы многих современных птиц красуются перед самками длинными хвостовыми перьями, больше ни на что не годными и только мешающими летать, причем самки отдают предпочтение тем женихам, у которых эти перья длиннее. Палеонтологи и раньше предполагали, что у некоторых пернатых динозавров крупные и непригодные для других целей перья могли служить для брачных демонстраций, но такого «явного» случая до сих пор не находили. Это исследование, наряду со многими другими, показало, что происхождение птичьих перьев — типичный пример смены функции органа в эволюции. Перья сначала развились для термоизоляции, и, возможно, для улучшения аэродинамических качеств динозавра при быстром беге; потом начали использоваться для брачных демонстраций, и, наконец, пригодились для планирующего, а затем и для машущего полета.

2) Малый размер птичьих геномов — наследие эпохи динозавров. Американские и британские палеонтологи в 2007 году показали, что по микроструктуре ископаемых костей можно судить о размере генома вымерших четвероногих. Оказалось, что одна из отличительных особенностей современных птиц — малый размер генома — была характерна для предков птиц (динозавров-теропод) с самого начала их истории. Это еще одна «птичья» черта, которая, наряду с перьями и некоторыми особенностями скелета, сформировалась у динозавров задолго до того, как они научились летать.

3) Предки птиц, возможно, были четырехкрылыми. В юрских отложениях провинции Ляонин (Северо-Восточный Китай) в 2009 году найден хорошо сохранившийся экземпляр оперенного «птицединозавра» Anchiornis huxleyi, жившего на несколько миллионов лет раньше археоптерикса. Находка показала, что предки птиц, по-видимому, изначально имели крупные контурные перья, пригодные для полета, не только на передних, но и на задних конечностях. Данная находка — еще один яркий пример сбывшегося эволюционного предсказания. Палеонтологи понимали, что должны были существовать полуптицы-полудинозавры, более древние и при этом более близкие к рептилиям, чем археоптерикс. Однако до сих пор все находки такого рода были более молодыми (эксперименты по «орнитизации» среди динозавров продолжались еще долго после появления настоящих птиц). Теперь, наконец, найден и искомый пернатый «до-археоптериксовый» динозавр.

Anchiornis huxleyi. Видны отпечатки крупных контурных перьев, располагавшихся на всех четырех конечностях и на хвосте. Длина масштабной линейки — 5 см.


4) Как велоцираптор разучился летать. На кости велоцираптора из Монголии в 2007 году были обнаружены специальные бугорки, к которым крепились перья. Стало понятно, что не только мелкие представители теропод имели перья и летали, но и крупные, явно нелетающие динозавры также имели перьевой покров.

На схеме показаны основные ветви эволюции динозавров, приведшие к птицам. Красные прямоугольники отмечают найденные (а не предполагаемые!) признаки перьев у этих рептилий. А цифры показывают 4 события гигантизма. Видно, что рептилии, находящиеся в основании древа, мелкие. Эта схема не учитывает вышеупомянутого четырехкрылого динозавра Anchiornis huxleyi, который был найден лишь в 2009 году, и птицединозавра Epidexipteryx с четырьмя длинными хвостовыми перьями, найденного в 2008 году.

5) В Китае нашли кости гигантского птицеподобного динозавра. В 2007 году китайские палеонтологи сообщили о находке еще одного необычного динозавра, близкого к предполагаемым предкам птиц и получившего название Gigantoraptor erlianensis. В отличие от других птицеподобных динозавров, вес которых редко превышал 40 кг, гигантораптор был настоящим гигантом и весил около полутора тонн.

6) В Китае нашли мохнатого динозавра. В 2009 году был найден небольшой (около 70 см) растительноядный динозавр из группы гетеродонтозавров, живший около 125 млн лет назад. Вместе с костями сохранились пучки длинных нитевидных образований, похожих на волосы, а еще больше — на «протоперья», характерные для некоторых ящеротазовых манирапторных динозавров — предков птиц. Наличие протоперьев у неродственного птицам динозавра показывает, что мохнатые (или оперенные) формы встречались среди динозавров чаще, чем было принято считать.

Другие переходные формы между крупными таксонами

Известно множество других переходных форм, в том числе — от беспозвоночных к рыбам, от рыб к четвероногим, от земноводных к рептилиям, от рептилий к млекопитающим (см. также: List of transitional fossils). Все эти хрестоматийные примеры имело бы смысл разобрать подробно, однако нельзя объять необъятное, поэтому приходится ограничиться ссылками.

Палеонтологи постоянно находят все новые и новые переходные формы и «недостающие звенья», и в результате общая картина развития жизни на Земле становится все более полной и объемной. Вот несколько избранных примеров переходных форм, найденных палеонтологами совсем недавно:

1) Новая палеонтологическая находка проливает свет на раннюю эволюцию млекопитающих. В 2007 году в Китае был найден скелет млекопитающего, жившего 125 млн лет назад, в строении которого удивительным образом сочетаются примитивные и продвинутые признаки. Находка подтвердила теоретические построения, согласно которым в эволюции среднего уха млекопитающих должна была быть промежуточная стадия, когда слуховые косточки уже не составляли единого целого с нижней челюстью, но еще оставались связанными с ней посредством особого хряща (таким образом, эта находка — еще один яркий пример сбывшегося эволюционного предсказания). Находка также подтвердила, что многие прогрессивные признаки высших млекопитающих формировались параллельно в разных эволюционных ветвях.

2) Палеонтологи выяснили родословную лягушек и саламандр В 2008 году Техасе было найдено долгожданное «недостающее звено» между современными лягушками и саламандрами и древними примитивными четвероногими — лабиринтодонтами. Изучение скелета ископаемой амфибии, жившей 270–280 млн лет назад (ранняя пермь) и получившей название Gerobatrachus, показало, что предками лягушек и саламандр были темноспондильные лабиринтодонты. «Переходный» статус геробатрахуса подтверждается строением всех частей скелета: черепа, позвоночника, поясов конечностей. Как говорилось выше, при становлении новых групп животных эволюция разных морфологических признаков идет с разной скоростью. Поэтому большинство классических «переходных форм» представляют собой мозаику примитивных и продвинутых признаков. Геробатрахус — не исключение. Одни признаки сближают его с типичными представителями группы Temnospondyli, другие — с лягушками, третьи — с саламандрами, четвертые находятся в промежуточном состоянии. Например, промежуточным является число позвонков: у геробатрахуса между черепом и тазом насчитывается 17 позвонков, у его ближайших темноспондильных родственников — 21, а у лягушек и саламандр — 14–15. Авторы находки особо отмечают, что общие пропорции тела, форма черепа, укороченные туловище и хвост сразу же создают у специалиста впечатление, что перед ним — палеозойский представитель батрахий (группы, объединяющей саламандр и лягушек). И это при том, что палеозойских батрахий никто ранее не видел. Иными словами, геробатрахус полностью соответствует «идеальному образу» общего предка лягушек и саламандр, который успел сложиться у специалистов к настоящему времени.

Скелет геробатрахуса — переходной формы между древними лабиринтодонтами и батрахиями (группой, объединяющей саламандр и лягушек).

3) Ископаемые рыбы в очередной раз подтвердили правоту Дарвина Излюбленным аргументом противников Дарвина с давних пор была кажущаяся неспособность его теории объяснить происхождение камбалообразных рыб. Утверждалось, что перемещение глаза с одной стороны головы на другую не могло происходить постепенно, потому что на начальных этапах эти изменения не приносили бы никакой пользы своим обладателям. Однако найденные в 2008 году в эоценовых (56–40 млн лет) отложениях Италии и Франции ископаемые переходные формы в очередной раз подтвердили правоту эволюционной теории. Эти ископаемые рыбы имеют то самое строение черепа, которое противники Дарвина считали «невозможным»: череп резко асимметричен, одна глазница уже сместилась наверх, но оба глаза еще находятся по разные стороны головы.

4) Как рыбы научились ходить (Тиктаалик)

5) Первые позвоночные начали осваивать сушу раньше, чем предполагалось (Вентастега — между Тиктааликом и Акантостегой)

6) Найдено «недостающее звено» между членистоногими и загадочными кембрийскими чудовищами аномалокарисами

7) Новый представитель аномалокарид прояснил эволюцию членистоногих

8) Обнаружено ископаемое животное, близкое к общим предкам моллюсков и кольчатых червей

9) Самые древние зайцеобразные — из Индии или из Монголии?


В некоторых случаях ископаемые переходные формы обнаружить не удалось, например — нет следов эволюции шимпанзе (предположительно это объясняется отсутствием условий для образования окаменелостей во влажных тропических лесах, где они живут), нет достоверных следов ресничных червей, а этот класс объединяет более 3500 современных видов. Разумеется, чтобы фальсифицировать теорию эволюции, недостаточно указать на подобные пробелы в палеонтологической летописи. Чтобы опровергнуть эволюционное учение, потребовалось бы предъявить скелет, не соответствующий филогенетическому дереву или не укладывающийся в хронологическую последовательность. Так, в ответ на вопрос о том, какая находка могла бы сфальсифицировать эволюционную теорию, Джон Холдейн отрезал: «Ископаемые кролики в докембрии!» Были найдены миллионы окаменелостей, около 250000 ископаемых видов, и каждая находка — это проверка теории эволюции, а пройденная проверка подтверждает теорию.

В тех случаях, когда палеонтологическая летопись оказывается особенно полна, мы видим так называемые филогенетические (эволюционные) ряды, то есть ряды видов, последовательно сменяющих друг друга в процессе эволюции. Выше мы рассмотрели пример эволюционного ряда, в котором изменения ограничились появлением новых видов в пределах одного и того же рода. Из рядов, в которых происходили более крупные изменения, широко известны филогенетические ряды человека и лошади (см. ниже), а также сирен, китообразных и многие другие (см. также великолепные иллюстрации в статье по эволюции китообразных: Thewissen et al., 2009. From Land to Water: the Origin of Whales, Dolphins, and Porpoises).

Схема эволюции китообразных, основанная на палеонтологических данных. См. также: Cetacean Evolution (Whales, Porpoises, Dolphins) by Edward T. Babinski

Эволюция человека

См. также: Обзор достижений палеоантропологии, генетики, эволюционной психологии; Антропогенез

Черепа гоминид, от шимпанзе (A) до человека разумного (N) Images © 2000 Smithsonian Institution)

• (A) Pan troglodytes, шимпанзе, современный

• (B) Australopithecus africanus, STS 5, австралопитек африканский, 2.6 млн. лет

• C) Australopithecus africanus, STS 71, австралопитек африканский, 2.5 млн. лет

• (D) Homo habilis, KNM-ER 1813, человек умелый, 1.9 млн лет

• (E) Homo habilis, OH24, человек умелый, 1.8 млн лет

• (F) Homo rudolfensis, KNM-ER 1470, человек рудольфийский, 1.8 млн лет

• (G) Homo erectus, Dmanisi cranium D2700, человек прямоходящий (или, по другой номенклатуре, «человек грузинский», Homo georgicus), 1.75 млн лет

• (H) Homo ergaster (ранний H. erectus), KNM-ER 3733, человек прямоходящий, 1.75 млн. лет

• (I) Homo heidelbergensis, «Rhodesia man,», гейдельбергский человек, 300,000–125,000 лет

• (J) Homo sapiens neanderthalensis, La Ferrassie 1, неандерталец, 70,000 лет

• (K) Homo sapiens neanderthalensis, La Chappelle-aux-Saints, неандерталец, 60,000 лет

• (L) Homo sapiens neanderthalensis, Le Moustier, неандерталец, 45,000 лет

• (M) Homo sapiens sapiens, Cro-Magnon I, человек разумный («кроманьонец»), 30,000 лет

• (N) Homo sapiens sapiens, современный человек.

Не все формы, показанные на этом рисунке, являются представителями единой эволюционной линии — есть среди них и «боковые веточки». Впрочем, это не столь важно, потому что, как уже говорилось, «переходные формы» между А и Б — это не обязательно прямые предки Б; для реконструкции путей эволюции достаточно и близких родственников этих предков или их малоизменившихся потомков.

Но, положа руку на сердце, скажите: разве соседние черепа гоминид на этом рисунке отличаются друг от друга намного сильнее, чем соседние панцири морских ежей на рисунке, приведенном выше? На самом деле в случае гоминид различия действительно больше («ежовый» ряд включает 8 видов одного и того же рода, а на последнем рисунке показаны представители трех родов гоминид), но, согласитесь, не намного. Однако в случае с ежами креационисты отмахиваются: «ерунда, ёж остался ежом, подумаешь — микроэволюция! Покажите нам МАКРОэволюцию!». А в случае с черепами гоминид реакция антиэволюционистов почему-то принципиально иная. «Это все подделки! Между этими черепами нет ничего общего! Вот это — просто обезьяны, а вот то — просто современные люди!» Странно, не правда ли?

Первый скелет неандертальца был найден в 1856 году, за три года до опубликования «Происхождения видов». На момент выхода книги не было известно никаких других ископаемых видов, подтверждающих эволюционное происхождение человека и шимпанзе от общего предка. С тех пор было найдено множество скелетов промежуточных форм между человеком и шимпанзе (точнее, между человеком и ближайшим общим предком человека и шимпанзе).

Поскольку общий предок человека и шимпанзе передвигался на четырех конечностях, а мозг у него был не больше чем у шимпанзе, согласно теории в процессе эволюции должно было развиться прямохождение, а также должен был увеличиться объем мозга. Таким образом, должен был существовать один из трех вариантов промежуточной формы:

1) Промежуточный размер мозга, развивающееся прямохождение.

2) Размер мозга примерно как у шимпанзе, развитое прямохождение.

3) Большой мозг, прямохождение не развито.

В 1920-х годах в Африке были обнаружены останки существа, которое Раймонд Дарт назвал австралопитеком. Позднее были найдены и другие останки австралопитеков, в том числе — знаменитая Люси и череп AL 444-2. Австралопитеки жили в восточной и северной Африке с 4 по 2 миллиона лет назад. Объем мозга австралопитека был немного больше, чем у шимпанзе. Кости таза по строению близки к костям таза человека. Строение черепа характерно для прямоходящих животных, что можно определить в частности по foramen magnum — отверстию в затылочной кости, соединяющему полость черепа с позвоночным каналом. Более того, в Танзании в окаменевшем вулканическом пепле были обнаружены «человеческие» следы, возраст которых составляет 3.6 миллионов лет. Таким образом, австралопитеки представляют собой «переходную форму номер два»: у них было развитое прямохождение, но мозг был примерно как у шимпанзе.

Позднее были найдены останки ардипитека, возраст которых около 4.5 миллионов лет. Анализ скелета показал, что по земле ардипитеки передвигались на двух задних конечностях, а по деревьям лазали на всех четырех. Прямохождение у ардипитеков было слабо развито по сравнению с последующими гоминидами (австралопитеками и людьми), они не могли преодолевать большие расстояния (подробнее об ардипитеке см. в заметках: Предки человека не были похожи на шимпанзе и Семейные отношения — ключ к пониманию эволюции человека). Ардипитек — типичная переходная форма, в данном случае — между общим предком человека и шимпанзе и австралопитеком.

Итак, в ходе эволюции у гоминид сначала развилось прямохождение, и только много позже началось существенное увеличение объема мозга. У австралопитеков, живших 4–2 миллиона лет назад, объем мозга был около 400 см³, примерно как у шимпанзе. Человек умелый (Homo habilis) жил 2.4–1.4 миллионов лет назад (кости известны начиная с 2 млн лет, более древние находки представлены только каменными орудиями), размер мозга у него был 500–640 см³. Человек работающий (Homo ergaster) жил 1.9–1.4 миллионов лет назад, размер мозга — 700–850 см³. Человек прямоходящий (Homo erectus) жил 1.4–0.2 миллионов лет назад, размер мозга составлял от 850 см³ у ранних особей до 1100 см³ у поздних. Гейдельбергский человек (Homo heidelbergensis) жил 600–350 тысяч лет назад, размер мозга составлял 1100–1400 см³. Неандертальцы (Homo neanderthalensis) жили 350-30 тысяч лет назад, размер мозга составлял 1200–1900 см³. 200 тысяч лет назад появился человек разумный (Homo sapiens), размер мозга 1000–1850 см³. Перечисленные виды хорошо представлены в палеонтологической летописи. См. описания ископаемых гоминид и большую подборку литературы по теме в обзоре «Происхождение человека«

Согласно Дарвину, «в ряду форм, незаметно переходящих одна в другую от какого-либо обезьянообразного существа до человека в его современном состоянии, было бы невозможно точно указать, которой именно из этих форм следует впервые дать наименование „человека“.» Именно с этой проблемой и столкнулись современные палеонтологи, вынужденные делить найденные останки гоминид на разные роды и виды. Например, черепа KNM ER 1813, KNM ER 1470 и OH 24 («Твигги») в разное время классифицировались как Australopithecus habilis и как Homo habilis, просто потому что они оказались на искусственной границе, произвольно проведенной между плавно переходящими друг в друга родами Australopithecus и Homo.


Подробный популярный рассказ о новейших достижениях в изучении эволюции человека: Обзор достижений палеоантропологии, генетики, эволюционной психологии.

Палеонтологическая история гоминид изучена лучше, чем большинства других групп животных. Перед лицом такого количества неопровержимых фактов антиэволюционистам не остается ничего другого, кроме как идти на прямую ложь. Они то пытаются замолчать существование находок, то отрицают их подлинность или возраст, то объявляют подделками (благо в 150-летней истории палеоантропологии действительно было несколько случаев подделок), то пытаются применить свой излюбленный эссенциалистский прием «это просто обезьяна, а то — просто современный человек». Все это может убедить лишь человека, совершенно не знакомого с фактами. Часто повторяемый (хотя и малозначительный по сути) аргумент антиэволюционистов о том, что первооткрыватель питекантропа Эжен Дюбуа якобы в конце жизни признал, что найденная им на Яве черепная крышка принадлежала гигантскому гиббону, тоже оказался ложью. На самом деле Дюбуа говорил лишь о том, что найденная им черепная крышка обезьяночеловека настолько необычна, непохожа на человеческую, что ее можно принять за кость гигантского гиббона (R. Dawkins, 2009. «The Greatest Show on Earth»).

См. также: Черепа австралопитеков изучены чуть ли не лучше, чем черепа разных рас современного человека (Станислав Дробышевский о современной антропологии)

Эволюция лошади

Эволюция лошади. Показана реконструкция ископаемых видов, полученных из последовательных слоев осадочных отложений. Справа — вид спереди передней левой ноги с выделенным третьим сегментом, а также зуб в продольном сечении.


Эволюция лошади достаточно полно прослеживается в Северной Америке. Древнейший представитель лошадиных — гиракотерий (Hyracotherium, также известный как Eohippus) — был размером с лисицу и жил в Северной Америке 54 миллиона лет назад (нижний эоцен), а затем распространился в Европу и в Азию. Это было животное легкого, стройного телосложения, с короткими ногами, но приспособленное к бегу. У него было четыре пальца на передних ногах и три пальца на задних, пальцы располагались практически вертикально. Резцы были маленькие, коренные зубы приплюснуты и покрыты сверху эмалью.

Вероятный путь развития лошадей от гиракотериев к современному виду включает не менее 12 родов и несколько сотен видов. При этом произошли следующие изменения:

• Увеличение размера (от 0.4 м до 1.5 м);

• Удлинение ног и стопы;

• Редукция боковых пальцев;

• Удлинение и утолщение среднего пальца;

• Увеличение ширины резцов;

• Приобретение премолярами (предкоренными зубами) формы, характерной для моляров;

• Удлинение зубов.

• Увеличение высоты коронки коренных зубов.

Судя по ископаемым растениям из различных слоев, болотистая местность, в которой обитал гиракотерий, постепенно становилась суше. Предки лошадей стали полагаться на улучшенный за счет поднятой головы обзор и на высокую скорость бега для спасения от хищников. Если при ходьбе по мягкой болотистой почве большое число пальцев на конечностях было оправдано, то в изменённых условиях жизни для первобытных лошадей стало более выгодным, когда боковые пальцы у них стали постепенно отмирать, а средние — развиваться. Изменение строения зубов объясняется изменением рациона, а именно — переходом с мягкой растительности на траву.

Иногда у лошадей развиваются один или два лишних пальца, чаще всего встречается 2-й (внутренний) палец с вполне развитыми пястными или плюсневыми костями, вполне развитыми суставами пальца и копытом, которое, впрочем, редко касается земли. В случае развития двух лишних пальцев нога получает сходство с ногами предковых видов.

«Микро» и «макро»

Антиэволюционисты, как уже говорилось, в последнее время все чаще соглашаются признать то, что они называют «микроэволюцией» — то есть такие эволюционные изменения, которые можно непосредственно наблюдать в эксперименте или в природе, и которые доказаны настолько убедительно, что даже самые закоренелые антиэволюционисты уже не знают, как это «опровергать», не выставляя себя на посмешище. Сейчас антиэволюционисты, как правило, говорят, что отрицают только то, что они называют «макроэволюцией», то есть крупные эволюционные изменения. В качестве примера «макроэволюционного» события часто называют «выход рыб на сушу», то есть превращение первичноводных позвоночных (рыб) в наземных (четвероногих, или тетрапод).

В науке термином «микроэволюция» принято обозначать эволюционные изменения внутри вида. Акт видообразования считается «пограничным» событием, а появление надвидовых таксонов (новых родов, семейств и т. д.) называют «макроэволюцией». Однако в последние десятилетия эти термины употребляются все реже и реже. Библиотека Pubmed, упоминавшаяся во вводной части, содержит свыше 260,000 статей с ключевым словом «эволюция», но всего-навсего 193 статьи со словом «макроэволюция» и 358 статей со словом «микроэволюция» (по состоянию на 4 марта 2010 г.) Почему же эти термины выходят их моды? Дело в том, что большинство биологов обоснованно считает, что микро- и макроэволюция ничем принципиально не отличаются друг от друга. Точнее говоря, макроэволюция — это просто-напросто суммарный результат множества последовательных микроэволюционных событий. Все упирается в масштаб рассмотрения: когда у нас есть детальная информация (лабораторный эксперимент или очень подробный эволюционный ряд в палеонтологической летописи), мы видим, как правило, последовательность микроизменений. Если же мы рассмотрим только начало и конец длинного ряда (как в случае с эволюцией гоминид, см. выше), то, сравнивая их между собой, можно говорить уже о макроизменениях. Именно такая ситуация получается в том случае, когда не найдены промежуточные формы между двумя крупными таксонами: мы видим значительные изменения и говорим о макроэволюционном «событии». Лишь в редких случаях удается в лаборатории или в природе наблюдать нечто похожее на «макроэволюционное» событие (см. раздел «Эво-дево: следы макроэволюции«). Однако такое сверхускоренное возникновение новых видов с измененным планом строения — это скорее исключение, чем правило. В большинстве случаев на крупные «макроэволюционные» изменения в природе уходят даже не миллионы, а десятки миллионов лет, и складываются они из множества последовательных «микроизменений».

Как говорилось в разделе «Наблюдаемая эволюция», ученым удается, несмотря на все трудности и низкие вероятности, реально наблюдать процесс видообразования в природе и эксперименте. Но можем ли мы точно так же пронаблюдать появление нового семейства? По-видимому, не можем, и вовсе не потому, что таких событий в природе не бывает, а просто по определению, в силу того обстоятельства, что никакая новая форма, выведенная в лаборатории или возникшая на наших глазах в природе, не будет признана новым семейством. Биологи не станут выделять ее в новое семейство именно потому, что все произошло так быстро. Нравится нам это или нет, но ранг семейства биологи присваивают группе только в ретроспективе, когда группа уже «набрала силу», накопила запас изменчивости, разделилась на роды и виды, одним словом, «доказала» всей своей эволюционной историей, что заслуживает семейственного ранга. Даже если в результате «макромутации» возникнет необычная форма с измененным планом строения, потребуются миллионы лет, чтобы выяснить, можно ли эту форму считать родоначальником нового семейства, или это был просто бесперспективный уродец, обреченный на вымирание, или аберрантный представитель предкового семейства, от которого так и не произошло ничего принципиально нового.

Поэтому мы можем реально наблюдать «настоящие» макроэволюционные события только в ископаемой летописи, когда удается найти хорошие филогенетические ряды, соединяющие предковый таксон (например, лопастеперых рыб) с таксоном-потомком (например, первыми бесспорными тетраподами), о котором нам уже заранее известно, что от него в будущем действительно произошло что-то большое, важное и принципиально новое (например, все наземные позвоночные).

Рассмотрим эту ситуацию подробнее. Лопастеперые рыбы дали начало первым наземным позвоночным в конце девонского периода. Это «макроэволюционное событие» довольно детально документировано в ископаемой летописи. Переход от рыб к тетраподам растянулся примерно на 20–25 млн лет (385–360 млн лет назад) и состоял из множества последовательных мелких шажков, ни один из которых по отдельности никак «не тянет» на статус макроэволюционного.

Легкие (и, соответственно, два круга кровообращения) были, судя по палеонтологическим данным, у большинства или даже у всех девонских лопастеперых рыб. Они сохранились и у некоторых современных рыб. В девоне было понижено содержание кислорода в атмосфере, а доля углекислого газа, наоборот, была повышена по сравнению с современностью. Поэтому в воде, особенно на мелководье, рыбам было трудно дышать одними жабрами. Они заглатывали воздух, как это делают и современные рыбы, и у них образовались впячивания пищевода для удержания пузырей воздуха. Эти впячивания и есть легкие. Они выполняли сразу две функции — примитивных легких и примитивного плавательного пузыря. В дальнейшем у большинства костных рыб эти древние легкие стали отделяться от пищевода и превратились в «настоящий» плавательный пузырь. Генетический анализ показал, что из современных рыб ближайшими родственниками тетрапод являются двоякодышащие. У двоякодышащих рыб есть и легкие, и два круга кровообращения, и трехкамерное сердце — совсем как у амфибий, которые относятся к настоящим тетраподам.

По сути дела, основное, что изменилось при переходе от рыб к тетраподам — это строение конечностей. Но конечности (плавники) девонских лопастеперых рыб не так уж сильно отличались по своему строению от лап примитивных тетрапод. А главное, можно в деталях проследить изменения конечностей в эволюционном ряду, соединяющем рыб и тетрапод. На сегодняшний день этот филогенетический ряд включает около дюжины последовательных переходных форм, из которых можно упомянуть наиболее важные (в порядке убывания рыбьих и накопления тетраподных черт строения): Eusthenopteron, Panderichthys, Tiktaalik, Elpistostege, Livoniana, Elginerpeton, Ventastega, Metaxygnathus, Acanthostega, Ichthyostega, Tulerpeton (жирным шрифтом выделены роды, у которых известно строение конечностей; у остальных конечности сохранились плохо или вовсе пока не найдены). Первый род в этом списке — еще «типичная рыба», последний — бесспорная амфибия. Посередине помещаются все промежуточные этапы этого «макроэволюционного» преобразования.

Упрощенная схема перехода от лопастеперых рыб к первым тетраподам. Этот рисунок использовался на «обезьяньем процессе» в Пенсильвании в 2005 г. для иллюстрации ложности заявлений креационистов об отсутствии переходных форм между рыбами и амфибиями (процесс, как известно, выиграли эволюционисты, несмотря на то, что судья Джонс, выносивший вердикт, был консерватором, сторонником Буша и очень религиозным человеком). На этой картинке еще нет тиктаалика, который был найден позже.

Более точные рисунки передних конечностей пандерихта и тиктаалика (предоставил А.Н.Кузнецов).

Уже у Eusthenopteron в переднем плавнике имелась кость, соответствующая плечевой кости тетрапод (показана желтым цветом), и две кости, соответствующие будущим локтевой и лучевой костям (показаны коричневым и зеленым цветом). «Дистальные элементы», соответствующие будущей кисти тетрапод, показаны черным цветом. У пандерихта строение этих дистальных элементов еще оставалось относительно неупорядоченным. У тиктаалика они приобрели чуть более «оформленный» вид, так что становится уже более-менее понятно, откуда взялись у потомков тиктаалика пальцы. Тиктаалик и пандерихт уже могли сгибать свой передний то ли плавник, то ли лапу в суставе, который у их потомков назовут «локтевым». Также у тиктаалика произошла утрата жаберной крышки (которая еще была у пандерихта), что еще на шажок приближает тиктаалика к тетраподам. Утрата жаберной крышки автоматически привела к исчезновению костной связи между поясом передних конечностей и черепом.

У вентастеги и ряда других форм, которые по строению черепа занимают промежуточное положение между тиктааликом и акантостегой, к сожалению, от конечностей почти ничего не сохранилось.

Передняя конечность акантостеги и других ранних тетрапод

Конечности древнейших животных, которых безоговорочно относят уже к тетраподам, то есть к первым амфибиям (акатностега, ихтиостега), представляют собой всего лишь еще один небольшой шажок в сторону дифференциации дистальных частей скелета, т. е. кисти. У акантостеги еще сохранялись внутренние жабры, у ихтиостеги они уже редуцировались (наружные жабры у личинок амфибий сохраняются и сегодня). В дальнейшем у древнейших амфибий происходило постепенное развитие шейного отдела. Совершенно непонятно, где в этом ряду находится искомый великий «макропереход». Сказать, что переход от эустеноптерона к пандерихту и от пандерихта к тиктаалику — это «микро», а вот от тиктаалика к акантостеге — это уже «макро», может только очень предвзятый человек. И, конечно, среди специалистов-палеонтологов нет никого, кому пришло бы в голову это утверждать.

Можно уверенно сказать, что если бы формы, подобные акантостеге и тулерпетону, вымерли, так и не дав начало большой разнообразной группе наземных позвоночных, независимый наблюдатель (скажем, марсианин или какой-нибудь разумный осьминог) никогда бы не выделил их в особый класс, а классифицировал бы как своеобразную тупиковую ветвь полуводных лопастеперых рыб. А осьминоги-креационисты говорили бы: «Это обычная микроэволюция! Рыба осталась рыбой. Покажите нам МАКРОэволюцию!»

Аналогичная ситуация наблюдается сейчас у некоторых современных костистых рыб, которые уже в кайнозое стали предпринимать новые «попытки» освоить сушу, порой весьма успешные. У этих современных рыб предпосылок для выхода на сушу гораздо меньше, чем у их девонских предшественников. Бывшие легкие у них уже «истрачены» на плавательный пузырь, а задние конечности (брюшные плавники) пришли в негодное для превращения в ноги состояние. Тем не менее илистый прыгун ловко ходит по суше, опираясь на грудные плавники и помогая себе хвостом, дышит воздухом при помощи нового, довольно «кустарного» и малоэффективного органа воздушного дыхания, который сформировался у него в ротовой полости. Эта удивительная рыба способна питаться на суше и даже размножается на берегу в «башенках» из глины, на дне которых она устраивает лужицу, где и развивается икра.

Мы не знаем, дадут ли илистые прыгуны начало новой волне сухопутной экспансии рыб. Может, и дадут, хотя сейчас у них на суше многовато конкурентов. Если все же от них произойдет новая большая сухопутная группа, зоологи будущего придадут ей высокий ранг, а на ее родоночальников — нынешних илистых прыгунов — будут смотреть уже совсем другими глазами. Ну а пока, разумеется, «рыба осталась рыбой».

Илистые прыгуны — далеко не единственные рыбы, которые в наши дни в той или иной мере «воспроизводят» то давнее макроэволюционное событие. Еще один пример — мелководные удильщики антеннарииды. Они не выходят на сушу, однако грудные плавники у них приобрели поразительное сходство с лапами четвероногих. У них есть даже нечто вроде пальчиков!

Удильщики при помощи своих лап ползают по дну и держатся за камни, чтобы их не болтало волнами. Как видим, лапы могут быть полезны и под водой. Кстати, большинство палеонтологов считает, что и рассмотренные выше древнейшие тетраподы жили в основном в воде, и лапы у них сформировались преимущественно для подводных нужд (хотя попутно могли использоваться для переползания в другие водоемы).

Лапы удильщиков внешне и по своим движениям очень похожи на лапы тетрапод, но скелет у них другой. Иными словами, это аналогия, а не гомология (чего и следовало ожидать, учитывая независимое эволюционное происхождение этих лап).

Схема строения передних конечностей мелководного удильщика Antennarius и древней амфибии Tulerpeton. Гомологичные группы мышц показаны одинаковыми цветами. Синей линией показано «главное место сгиба»: у тулерпетона это локтевой сустав, а у удильщика — нечто совсем другое, но аналогичное по функции. Изображение предоставил А.Н.Кузнецов.

Можно составить морфологический ряд, восстановив эволюционный путь от обычного рыбьего плавника к «лапе» мелководного удильщика, и тогда креационисты скажут: «вот видите, это обычная микроэволюция, рыба осталось рыбой». Можно не строить ряда, и тогда креационисты скажут: «вот видите, это разумный дизайн». Ученым же эти примеры дают понять, что для рыбы выйти на сушу и стать наземным позвоночным — дело не такое уж хитрое. Причем такое «макро»-превращение в действительности складывается из суммы не очень сложных «микро»-изменений.

4. Морфологические доказательства

Введение

По мнению религиозных антиэволюционистов (включая сторонников «разумного замысла»), виды живых организмов были созданы разумным Существом, которое имело возможность проектировать каждый вид «с чистого листа», то есть разрабатывать для каждого вида свой собственный, уникальный план строения, наилучшим образом соответствующий тем задачам, которые, по замыслу Творца, данный вид должен был выполнять на Земле. Антиэволюционизм, таким образом, либо предсказывает наличие множества совершенных (идеальных), уникальных и никак не связанных между собой планов строения (что резко противоречит наблюдаемым фактам), либо вообще отказывается от предсказаний (а значит, и от возможности что-либо понять и объяснить в окружающем мире), ссылаясь на «неисповедимость воли Творца» («раз так создано, значит, так было угодно Богу, а почему — не наше дело»).

Наука, напротив, утверждает, что виды в ходе эволюции происходили друг от друга в силу естественных причин, без вмешательства разумных сил. При этом каждый вид не «проектировался с чистого листа», а появлялся в результате относительно небольших модификаций предкового вида, наследуя большинство его свойств — в том числе и те, которые новому виду не очень-то и нужны, и которые вовсе не обязательно являются оптимальными для тех условий, в которых живет новый вид. Поэтому, если идея эволюции верна, мы должны наблюдать в живой природе повсеместные следы происхождения путем модификации, то есть многочисленные свидетельства «переделки» и «подгонки» старых признаков (органов, тканей, планов строения) под новые условия (экологические ниши) и новые задачи (функции). Именно это мы и наблюдаем в природе. Яркие примеры предсказываемых эволюционной теорией «следов происхождения путем модификации» — это гомологичные органы, рудименты, атавизмы, а также многочисленные случаи явного несовершенства строения организмов.

Гомологичные органы

Органы животных разных видов, имеющие один и тот же план строения, занимающие сходное положение в организме животного и развивающиеся из одних и тех же зачатков, называют гомологичными. Если такие органы у разных видов выполняют разные функции, то единственное объяснение сходства строения — происхождение от общего предка. Напротив, если у двух видов независимо развились органы, выполняющие одну и ту же функцию (аналогичные органы), то сходство между этими органами оказывается поверхностным.

Пятипалая конечность

Иллюстрация принципа гомологии на примере передней конечности млекопитающих. Конечности состоят из одного и того же набора костей, но при этом выполняют самые разные функции. Третья кость пясти отмечена красным цветом.


Пятипалая конечность, характерная для четвероногих позвоночных — пример гомологии органов. Более того, прослеживается гомология пятипалой конечности и плавников некоторых ископаемых видов кистеперых рыб, от которых произошли первые земноводные.

Кости передних конечностей девонских кистеперых рыб (слева) и древнейших четвероногих (справа). Условную границу между рыбами и четвероногими чаще всего проводят между тиктааликом и акантостегой (см.: Как рыбы научились ходить).


Конечности четвероногих различаются по форме и приспособлены к выполнению самых различных функций в самых разных условиях. На примере млекопитающих:

• У обезьян передние конечности вытянуты, кисти приспособлены для хватания, что облегчает лазанье по деревьям.

• У свиньи первый палец отсутствует, а второй и пятый — уменьшены. Остальные два пальца длиннее и тверже остальных, концевые фаланги покрыты копытами.

• У лошади также вместо когтей копыто, нога удлинена за счет костей среднего пальца, что способствует большой скорости передвижения.

• Кроты имеют укороченные и утолщенные пальцы, что помогает при копании.

• Муравьед использует увеличенный средний палец для раскапывания муравейников и гнезд термитов.

• У кита передние конечности представляют собой плавники.

• У летучей мыши передние конечности развились в крылья за счет значительного удлинения четырех пальцев, а крючкообразный первый палец используется, чтобы висеть на деревьях.

При этом все эти конечности содержат один и тот же набор костей с одним и тем же относительным расположением. Единство структуры не может быть объяснено с точки зрения полезности, так как конечности используются для совершенно разных целей. Ни один «разумный дизайнер» никогда не стал бы проектировать крыло летучей мыши и лапу-лопату крота на основе одного и того же набора костей (плечевая, локтевая, лучевая, запястье, пясть, 5 пальцев). Ни один биолог и ни один инженер не смог бы доказать, что именно такой набор костей является идеальной основой для этих «проектов». А значит, единую структуру конечности четвероногие позвоночные унаследовали от общего предка. В ходе эволюции гомологичные части конечностей «подгонялись» естественным отбором к выполнению различных задач, что и обеспечивает кажущееся «совершенство» этих конечностей, их соответствие выполняемым функциям. Но это — явно не работа разумного проектировщика, ищущего наилучшее из возможных инженерных решений. Это — результат слепого природного процесса, который не способен заглядывать на шаг вперед и может только понемногу подправлять уже имеющиеся детали, «подгоняя» их к новым задачам.

Части ротового аппарата насекомых

Строение головы и ротового аппарата у различных видов насекомых. a, усики; c, фасеточный глаз; lb, нижняя губа; lr, верхняя губа; md, жвалы (верхние челюсти); mx, максиллы (нижние челюсти).


Основные части ротового аппарата насекомых — верхняя губа, пара жвал (верхних челюстей), подглоточник (hypopharynx), две максиллы (нижние челюсти) и нижняя губа. У разных видов эти составные части различаются по форме и размеру, у многих видов некоторые из частей утрачены. Особенности строения ротового аппарата позволяют насекомым использовать различные источники пищи (см. рисунок):

(A) В исходном виде (у наиболее примитивных насекомых, и, например, у кузнечика) сильные жвалы и максиллы используются для кусания и жевания.

(B) Медоносная пчела использует нижнюю губу для сбора нектара, а жвалами дробит пыльцу и разминает воск.

(C) У бабочки верхняя губа уменьшена, жвалы отсутствуют, максиллы образуют хоботок.

(D) У самок комаров верхняя губа и максиллы образуют трубку, жвалы используются для протыкания кожи.

Какой разумный дизайнер, имея возможность спроектировать трубочку для питья коктейля любой формы и из любого материала, стал бы изготавливать ее методом перековывания пары вилок? Кто стал бы делать шприц, вытягивая и заостряя «челюсти» пассатижей? Это — характерный и узнаваемый стиль естественного отбора, «слепого часовщика», мастера по подгонкам и переделкам, но никак не разумного и всемогущего дизайнера, которому доступны любые материалы и любые технические решения.

Рудименты

См. также: Рудиментарные органы

Рудиментами называются органы, утратившие своё основное значение в процессе эволюционного развития организма. Рудименты также можно определить как структуры, редуцированные и обладающие меньшими возможностями по сравнению с соответствующими структурами у других организмов. Многие рудиментарные органы не являются совершенно бесполезными и выполняют какие-нибудь второстепенные функции. Если рудимент и оказывается функциональным, то он выполняет относительно простые или малозначимые функции с помощью структур, очевидно предназначенных для более сложных целей. Отсутствие функций не является необходимым критерием рудиментарности. Такие органы крайне распространены в природе.

Например, птичье крыло — крайне сложная анатомическая структура, специально приспособленная для активного полета, но крылья страусов не используются для полета. Эти рудиментарные, хотя и достаточно сложно устроенные (как и у других птиц) крылья могут использоваться для сравнительно простых задач, таких как поддержание равновесия на бегу и привлечение самок — с тем же успехом можно приспособить микроскоп для заколачивания гвоздей. Таким образом, специфическая сложность крыльев страуса неадекватна простоте задач, для которых эти крылья используются, и именно поэтому эти крылья называют рудиментами. В числе других нелетающих птиц с рудиментарными крыльями — галапагосские бакланы (Phalacrocorax harrisi), киви и какапо. Для сравнения, крыло пингвина имеет большое значение, действуя в качестве плавника, а значит — не может считаться рудиментом.

Какапо — нелетающий новозеландский попугай. Вот что пишет о нем Ричард Докинз в книге «The greatest show on earth«:

Его летающие предки, очевидно, жили настолько недавно, что какапо все еще пытается летать, хотя уже не имеет средств, чтобы добиться успеха в этом начинании. По словам бессмертного Дугласа Адамса (в книге Last Chance to See), это чрезвычайно толстая птица. Взрослый какапо весит около шести или семи фунтов, а его крылья годны лишь для того, чтобы помахать ими немного для равновесия, когда ему кажется, что он может обо что-то споткнуться. Но о полете не может быть и речи. К сожалению, он, похоже, не только забыл, как летать, но и забыл, что он забыл, как летать. Сильно взволнованный какапо иногда вскарабкивается на дерево и прыгает оттуда, после чего он летит как кирпич и обрушивается на землю бесформенной грудой.

Впрочем, другие авторы иначе описывают прыжки какапо: по их мнению, он использует свои слабые крылья в качестве парашюта, и они позволяют ему даже немного планировать, так что он падает не совсем вертикально, а под углом до 450. В таком случае к нему приложимы те же рассуждения, что и к страусу: налицо использование «микроскопа для забивания гвоздей».

Примеры рудиментов:

• Глаза у некоторых пещерных и роющих животных, таких как протей, слепыш, крот, астианакс мексиканский (Astyanax mexicanus, слепая пещерная рыба). Эти глаза либо вообще ничего не видят, либо способны лишь отличать свет от тьмы (см.: 'Blind' mole can still tell night from day) и часто скрыты под кожей.

• Малая берцовая кость у птиц.

• У человека к рудиментам относятся:

• хвостовые позвонки;

• у некоторых людей имеется рудиментарная хвостовая мышца extensor coccygis, идентичная мышцам, двигающим хвост у других млекопитающих. Она прикрепляется к копчику, но, поскольку копчик у человека практически не может двигаться, эта мышца для человека бесполезна.

• волосяной покров туловища,

• специальные мышцы arrectores pilorum, которые у наших предков служили для «поднятия шерсти дыбом» (это полезно для терморегуляции, а также помогает животным выглядеть крупнее — для устрашения хищников и конкурентов). У людей сокращение этих мышц приводит к «гусиной коже», что едва ли может иметь какое-то адаптивное значение.

• три ушные мышцы, которые позволяли нашим предкам шевелить ушами. Встречаются люди, умеющие пользоваться этими мышцами. Это помогает животным с большими ушными раковинами определять направление на источник звука, но у человека данная способность может использоваться только для забавы.

• морганиевы желудочки гортани,

• червеобразный отросток слепой кишки (аппендикс). Многолетние наблюдения показали, что удаление аппендикса не оказывает значимого влияния на продолжительность жизни и здоровье людей, если не считать того, что после этой операции люди в среднем чуть реже болеют колитом (Coyne, 2009).

• хватательный рефлекс у новорожденных (детенышам обезьян он помогает держаться за шерсть матери).

• икота: это рефлекторное движение мы унаследовали от своих далеких предков — амфибий. У головастика данный рефлекс позволяет быстро пропустить порцию воды через жаберные щели. И у человека, и у головастика этот рефлекс контролируется одним и тем же отделом мозга и может быть подавлен одними и теми же средствами (например, вдыханием углекислого газа или расправлением грудной клетки). Подробнее об этом и других следах нашего эволюционного прошлого см. в статье Нила Шубина (известного палеонтолога, первооткрывателя тиктаалика) Fish out of water.

• лануго: волосяной покров, развивающийся у человеческого эмбриона почти на всем теле, кроме ладоней и ступней, и исчезающий незадолго до рождения (недоношенные дети иногда рождаются с лануго).

• У многих видов жуков, таких как Apterocyclus honoluluensis, крылья лежат под сросшимися надкрыльями. Многие другие виды насекомых, недавно утратившие способность к полету, такие как водяной скорпион Nepa cinerea, имеют внешне вполне нормальные крылья, которыми никогда не пользуются.

• У некоторых змей, в том числе у питона, имеются рудиментарные задние конечности.

Рудиментарные задние ноги у питона Python regius

• Остатки волосяного покрова и тазовых костей у некоторых китообразных. У зародышей китообразных иногда формируются вибриссы (чувствительные волоски на морде), которые впоследствии исчезают. Кроме костей таза, у некоторых китов сохраняется рудиментарная бедренная кость и даже совсем маленький хрящевой (не окостеневающий) остаток большой берцовой кости. У китов к этим рудиментам могут крепиться кое-какие мышцы, у самцов к ним прикреплены пещеристые тела пениса. Однако если эти кости были специально созданы «разумным дизайнером» для выполнения подобных второстепенных функций, совершенно непонятно, зачем было придавать этим костям столь глубокое онтогенетическое и структурное сходство (гомологию) с тазом и костями задних конечностей наземных млекопитающих.

Рудименты таза и костей задней конечности у молодого самца гренландского кита (Balaena mysticetus). Из статьи Thewissen et al., 2009. From Land to Water: the Origin of Whales, Dolphins, and Porpoises.

Атавизмы

См. также: Атавизм

Атавизмом называется появление у особи признаков, свойственных отдаленным предкам, но отсутствующих у ближайших. Появление атавизмов объясняется тем, что гены, отвечающие за данный признак, сохранились в ДНК, но не функционируют, так как подавляются действием других генов.

Примеры атавизмов:

• Хвостовидный придаток у человека;

• Сплошной волосяной покров на теле человека;

• Добавочные пары молочных желез;

• Задние ноги у китов;

• Задние плавники у дельфинов;

• Задние ноги у змей;

• Дополнительные пальцы у лошадей;

• Возобновление полового размножения у ястребинки волосистой и у клещей семейства Crotoniidae.

Яркий пример атавизма: дельфин с задними конечностями. Из статьи Thewissen et al., 2009. From Land to Water: the Origin of Whales, Dolphins, and Porpoises.


Аргументы в пользу эволюции тут те же, что и для рудиментов. Эволюционное объяснение рудиментов и атавизмов состоит в том, что органы (признаки), ставшие бесполезными для организма, не утрачиваются в одночасье, а могут сохраняться в течение миллионов лет, постепенно редуцируясь и разрушаясь под грузом мутаций (отбор перестает отбраковывать мутации, нарушающие развитие данного признака, и эти мутации начинают свободно накапливаться, но процесс этот очень медленный). По ходу дела, естественно, редуцирующийся орган может приобрести новые функции. Даже если внешнее проявление признака полностью утрачено, в геноме еще долго могут сохраняться фрагменты генетических «программ», обеспечивавших развитие данного признака у предков. При особых обстоятельствах (мутации, экстремальные воздействия на развивающийся эмбрион) эти программы могут иногда «сработать» — и тогда мы получаем атавизм.

Например, все современные птицы беззубы, но они произошли от зубастых предков. В соответствии с этим у куриного эмбриона можно вызвать такое нарушение нормального хода развития, что у него в челюстях сформируются зачатки зубов (см.: Mutant Chicken Grows Alligatorlike Teeth).

Еще один пример: у современных млекопитающих отсутствуют ребра на поясничных позвонках. Однако у далеких предков современных млекопитающих — примитивных мезозойских зверей, так же как и у их еще более далеких предков, зверозубых ящеров, ребра на поясничных позвонках имелись. Как выяснилось, мутации гена Hox10 могут приводить к появлению поясничных ребер у мышей, т. е. к типичному атавизму. Подробнее см. в заметке: Новая палеонтологическая находка проливает свет на раннюю эволюцию млекопитающих.

Несовершенство строения организмов

В ходе эволюции каждая новая конструкция не проектируется с нуля, а получается из старой конструкции за счет последовательности небольших улучшений. Эта особенность является причиной специфических несообразностей в строении живых организмов.

Например, возвратный гортанный нерв у млекопитающих идет от мозга к сердцу, огибает дугу аорты и возвращается к гортани. В результате нерв проходит гораздо более длинный путь, чем необходимо, а аневризма аорты может приводить к параличу левой голосовой связки. Особенно наглядно проблема видна на примере жирафа, у которого длина возвратного нерва может достигать 4 метров, хотя расстояние от мозга до гортани — всего несколько сантиметров. Такое расположение нервов и сосудов млекопитающие унаследовали от рыб, у которых шея отсутствует.

Расположение четвертой ветви блуждающего нерва у не имеющей шеи акулы вполне рационально. У жирафа, унаследовавшего относительное расположение нервов и кровеносных сосудов от далеких рыбообразных предков, путь гомологичной ветви блуждающего нерва (=возвратного гортанного нерва, recurrent laryngeal nerve) потрясающе нелеп: «за семь верст киселя хлебать». Рисунок из книги Р. Докинза «The greatest show on earth».


У ранних рыбообразных эмбрионов всех позвоночных животных возвратный гортанный нерв (= четвертая бранхиальная ветвь блуждающего нерва), отделившись от блуждающего нерва, проходит позади кровеносного сосуда шестой жаберной дуги и иннервирует соответствующую часть жаберного аппарата. У взрослых рыб нерв и сосуд остаются в том же самом положении. У предков млекопитающих в ходе эволюции кровеносный сосуд пятой жаберной дуги редуцировался, а сосуды четвертой и шестой дуг сместились (вслед за сердцем) в грудной отдел туловища. Здесь они стали аортой и боталловым протоком (ductus arteriosus) — поперечным сосудом, который у эмбрионов наземных позвоночных соединяет аорту с легочной артерией. Все эти события воспроизводятся в развитии эмбрионов. Вскоре после рождения боталлов проток зарастает и превращается в непроходимую для крови артериальную связку (ligamentum arteriosum). Но возвратный гортанный нерв, по-прежнему проходящий позади сосуда шестой дуги (т. е. боталлова протока), так и остается связанным с эмбриональными стуктурами той же дуги, которые не спускаются в грудной отдел, а остаются рядом с мозгом и превращаются в элементы гортани. По мере смещения сосуда шестой дуги нерву приходилось все более вытягиваться, становясь «возвратным». Эволюционная история нерва воспроизводится в развитии эмбрионов млекопитающих.


Желудочно-кишечный тракт млекопитающих пересекается с дыхательными путями, в результате мы не можем одновременно дышать и глотать, а кроме того существует опасность подавиться. Эволюционное объяснение данного обстоятельства заключается в том, что предками млекопитающих являются остеолепиформные кистепёрые рыбы, которые заглатывали воздух, чтобы дышать.

Выпадение матки, боли в пояснице у людей связаны с тем, что мы используем для прямохождения тело, сформированное эволюцией в течение сотен миллионов лет для передвижения на четырех конечностях.

Эволюция глаза

Еще один пример несовершенства в строении организмов — сетчатка позвоночных и слепое пятно. У позвоночных нервы и сосуды сетчатки расположены поверх светочувствительных клеток, а значит — свет должен пройти через несколько слоев клеток прежде чем попасть на палочки и колбочки. Слепое пятно — это отверстие в сетчатке, через которое нервы идут от сетчатки к мозгу. Для решения многочисленных проблем, вызванных таким устройством сетчатки, у позвоночных есть ряд адаптаций, в частности у нервов, идущих поверх сетчатки, отсутствует миелиновая оболочка, что повышает их прозрачность, но снижает скорость передачи сигнала (еще один пример «подгонок» и «подстроек», характерных для лишенного дара предвидения эволюционного процесса). Схожие по строению глаза головоногих лишены этого недостатка. Это наглядно показывает, что и у позвоночных могли бы быть глаза без слепых пятен.

Великий немецкий ученый XIX века Герман фон Гельмгольц сказал о человеческом глазе: «Если бы какой-нибудь оптик попытался продать мне инструмент со всеми этими дефектами, я бы счел себя в полном праве в самых сильных выражениях обвинить его в разгильдяйстве, и вернул бы ему его инструмент».

Упрощенная схема расположения нейронов сетчатки. Сетчатка состоит из нескольких слоев нейронов. Свет падает слева и проходит через все слои, достигая фоторецепторов (правый слой). От фоторецепторов сигнал передается биполярным клеткам и горизонтальным клеткам (средний слой, обозначен желтым цветом). Затем сигнал передается амакриновым и ганглионарным клеткам (левый слой). Эти нейроны генерируют потенциалы действия, передающиеся по зрительному нерву в мозг.


Причины, по которым глаз у позвоночных устроен так нелепо («вывернут наизнанку»), описаны, в частности, в книге Нила Шубина «Your inner fish». Они уходят корнями в самые ранние этапы эволюции хордовых. Далекие предки позвоночных животных, похожие на ланцетника, имели фоторецепторы, обращенные во внутреннюю полость спинной нервной трубки. Нервная трубка, в свою очередь, сформировалась путем впячивания нервной пластинки, представлявшей собой специализированный участок кожных покровов (эпителия). Таким образом, изначально фоторецепторы смотрели наружу, в сторону света, но при формировании спинной нервной трубки — характерной черты хордовых — они оказались обращенными во внутреннюю полость этой трубки (невроцель). Для животных, подобных ланцетнику, это не имеет особого значения, потому что они очень маленькие и совсем прозрачные. А главное, светочувствительные клетки у таких животных все равно не могли различать контуры объектов: они могли лишь отличать свет от тьмы, и четкость изображения для них не имела значения. Более сложные глаза позвоночных формировались из выпячиваний передней части нервной трубки, которая стала головным мозгом. При этом фоторецепторы так и остались обращенными вовнутрь — никакая мутация не могла бы вывернуть их наружу при таком способе формирования нервной системы, который позвоночные унаследовали от своих похожих на ланцетника предков. Разумеется, для «разумного дизайнера», начинающего проект с чистого листа, подобной проблемы просто не существовало бы.

Начало формирования нервной трубки из складки эпителия у человеческого зародыша.

Схема строения глаз современных моллюсков разной степени сложности — от простейшего светочувствительного пятна (у некоторых брюхоногих; вверху) до глаза, сравнимого по сложности и сходного по строению с человеческим (у осьминога; внизу) — наглядно показывает несостоятельность утверждений креационистов, будто такие сложные структуры, как глаза, не могли возникнуть постепенно, а значит, были сотворены такими, каковы они есть. Иллюстрация из книги Science, Evolution, and Creationism // Washington, D.C.: The National Academies Press. (PDF 3,2 Мб можно бесплатно скачать здесь, предварительно зарегистрировавшись).

Как видно из этой схемы, у моллюсков фоторецепторы как были изначально обращены наружу, к свету, так и остались; поэтому нервные волокна у них присоединяются к светочувствительным клеткам сзади, а не спереди, и нет никаких слепых пятен. Моллюскам в данном случае просто «повезло», что у них светочувствительные органы изначально не были связаны со впячивающимися (подобно зачатку нервной трубки хордовых) участками эпителия.

Типичный аргумент антиэволюционистов — аргумент от «несократимой сложности», который применительно к глазу звучит так: «сложный глаз (например, человеческий) не мог возникнуть путем постепенной эволюции, потому что глаз полезен только как целое — удалите какую-то часть глаза, и он станет бесполезен.» Приведенная выше схема показывает, как на самом деле может идти эволюция сложного глаза. Ключевая ошибка в рассуждениях антиэволюционистов состоит в том, что на самом деле глаз полезен не только «как целое», т. е. в полностью готовом виде. Простейший глазок, состоящий из нескольких светочувствительных эпителиальных клеток, способен только отличать день от ночи, но это все же лучше, чем никакого зрения вообще. Впячивание такого глазка дает дополнительное преимущество, позволяя определять направление на источник света. Дальнейшее впяивание превращает глаз в «камеру-обскуру«и позволяет уже различать объекты; последующее добавление хрусталика улучшает фокусировку, и т. д. Каждый маленький шажок на этом долгом эволюционном пути был выгоден организмам, и поэтому поддерживался естественным отбором.

Пост-транскрипционная регуляция работы генов

«Несовершенство дизайна» сплошь и рядом обнаруживается и на молекулярном уровне. Типичным примером является такое широко распространенное явление, как пост-транскрипционная регуляция активности генов (Post-transcriptional regulation). Когда деятельность какого-то гена не нужна в данной клетке или на данном этапе развития организма, ген может быть отключен простым и эффективным способом — при помощи специальных регуляторных белков (факторов транскрипции), которые отключают транскрипцию, то есть синтез матричной РНК на матрице ДНК. Однако во многих случаях тот же самый результат достигается другим, гораздо более расточительным способом: клетка сначала синтезирует матричную РНК, тратя на это много энергии и ресурсов, а затем сразу же уничтожает с таким трудом изготовленную молекулу. Инженерное решение, совершенно безграмотное и недопустимое с точки зрения любого разумного дизайнера! Однако именно таков стиль естественного отбора, который не умеет заглядывать вперед и слепо поддерживает те полезные мутации, которые ему «подвернулись» в данный момент. Например, посттранскрипционное «отключение» генов, осуществляемое при помощи микроРНК (см.: microRNA), по-видимому, появилось из-за того, что отбор «зацепился» за древнюю систему узнавания и обезвреживания чужеродных (например, вирусных) молекул РНК (см.: РНК-интерференция). Существуют весьма сложные и вычурные способы пост-транскрипционной регуляции генов. Например, в клетках есть система «молекулярной цензуры», которая служит для уничтожения бракованных и чужеродных молекул РНК. «Брак» распознается по конкретным простым признакам (например, по преждевременным стоп-кодонам). И поскольку такая система уже существует, она стала «зацепкой» для естественного отбора, который на ее основе создал очень замысловатую и, по-видимому, неэкономную систему регуляции. В синтезированную клеткой, но не нужную ей молекулу РНК вносятся такие изменения, что «цензура» воспринимает эту РНК как бракованную, подлежащую уничтожению (см.: Сравнение геномов человека и мыши помогло обнаружить новый способ регуляции работы генов). Зачем такие сложности — сначала синтезировать ненужную молекулу РНК, затем «подставить» ее надзирающим органам при помощи своеобразного молекулярного «подлога», и только после этого уничтожить? Ведь можно было с самого начала просто не синтезировать ее! Это характерный «почерк» эволюции, совсем не похожий на разумное проектирование, а похожий, скорее, на самосборку чего получится из чего попало. Если бы живая клетка была создана разумным дизайнером, он бы, конечно, решил эту задачу гораздо аккуратнее и красивее, например, при помощи факторов транскрипции. Но клетка делалась не разумным дизайнером, и это хорошо заметно, если присмотреться к деталям ее устройства и функционирования.

Еще один пример неоптимального дизайна — наличие дублирующих друг друга наборов генов рибосомных и транспортных РНК в ядерном и митохондриальном геномах. Митохондриальный геном мутирует гораздо чаще, чем ядерный, и поэтому многие люди страдают из-за наследственных «митохондриальных болезней». Часть этих болезней вызвана мутационной «поломкой» митохондриальных генов транспортных РНК. Человек страдает из-за того, что в его митохондриях испорчена одна из разновидностей транспортных РНК. При этом в цитоплазме тех же самых клеток полным-полно нормально работающих и точно таких же по функции транспортных РНК, кодируемых ядерным геномом. Но естественный отбор «не позаботился» создать систему переноса тРНК из цитоплазмы в митохондрии, и поэтому такие болезни практически неизлечимы. При этом подобная система, которая могла бы спасти многие тысячи людей, есть у лейшманий — паразитических жгутиконосцев (см.: Лекарство от наследственных болезней будут выделять из паразитического жгутиконосца).

5. Эмбриологические доказательства

Свидетельства эволюции в индивидуальном развитии организмов

Однажды после публичной лекции великого биолога Джона Холдейна некая дама заявила: «Не могу себе представить, чтобы из одноклеточного существа развился такой сложнейший организм, как человеческий, состоящий из триллионов клеток, даже если у него были на это миллиарды лет». На что Холдейн ответил: «Мадам, вы сами это проделали. И у вас ушло на это всего девять месяцев».

Многоклеточные организмы развиваются из единственной клетки — оплодотворенного яйца. В геноме многоклеточных нет «чертежа» взрослого организма, а есть только «программа поведения», работающая на уровне индивидуальных клеток. Многоклеточный организм формируется в результате согласованного поведения делящихся клеток эмбриона. До сих пор сохранились виды организмов, представляющие собой фактически переходные стадии между одноклеточными и многоклеточными, у которых в ходе жизненного цикла индивидуальные клетки самоорганизуются в сложные многоклеточные структуры. О самоорганизации сложных структур в результате согласованного поведения индивидуальных клеток см. в заметках:

Способность к сложному коллективному поведению может возникнуть благодаря единственной мутации

Амёбы-мутанты не позволяют себя обманывать

Зачем цианобактерии вьют из себя веревки

Микробиологи утверждают: многоклеточность — сплошное жульничество

«Чувство кворума»: принятие коллективных решений в макро- и микромире)

Очень важно понять, что эволюционируют не взрослые организмы, а генетические программы их индивидуального развития (онтогенеза). В ходе эволюции меняются не сами морфологические признаки, а генетически обусловленные алгоритмы их формирования в онтогенезе. Данные эмбриологии свидетельствуют о том, что алгоритм развития каждого вида живых организмов является модификацией алгоритмов развития его предков. Генетическая программа онтогенеза многоклеточных животных, как ни странно, сама по себе намного проще (содержит меньше информации), чем получающийся на ее основе взрослый организм. Новая информация «самозарождается» в ходе онтогенеза (в этом суть процесса самоорганизации). Чтобы понять эволюцию многоклеточных, необходимо четко представлять себе основные принципы онтогенеза (в доходчивой форме они описаны здесь). Возможные (допустимые, «разрешенные») пути эволюционных преобразований определяются не столько строением взрослого организма, сколько устройством его онтогенеза.


Понимание процессов самоорганизации имеет ключевое значение для понимания эволюции. Все мы неоднократно наблюдали такой яркий пример самоорганизации, как образование поразительно красивых и сложных морозных узоров на стекле. При этом у нас на глазах из «простого» (из хаотического движения молекул водяного пара) рождается «сложное» — изысканные ледяные картины, достойные кисти лучших художников. Мы понимаем, что эти узоры рисует не дед Мороз, они образуются сами. Но где они «закодированы», где хранится чертеж или программа, на основе которой они формируются? По-видимому, эта программа «закодирована» в физических свойствах молекулы воды, от которых зависит ход кристаллизации, а также в условиях среды (температура воздуха, текстура стекла и т. п.). Примерно таким же образом и программа развития организма закодирована в геноме и окружающей среде (нужно помнить, что строение взрослого организма зависит отнюдь не только от генов, но и от условий среды, в которой происходит развитие). Мы смиряемся с тем очевидным фактом, что и в ходе образования ледяных узоров, и в ходе развития организма происходит самопроизвольное образование новой информации (на основе простой программы самоорганизуется нечто значительно более сложное). Мы не считаем это чудом (хотя на чудо это очень похоже!) и не привлекаем сверхъестественные силы для объяснения каждой снежинки и каждого онтогенеза. Все сказанное в полной мере приложимо и к эволюционному развитию жизни. Наследственная изменчивость и дифференциальное размножение — это просто еще один механизм самоорганизации, благодаря которому из первоначальных простейших существ сами собой с неизбежностью развиваются те самые «endless forms most beautiful and most wonderful» (бесчисленные прекрасные и удивительные формы), которые населяют нашу планету. Подобно ледяным узорам, «закодированным» в молекуле воды и текстуре стекла, все это поразительное многообразие жизни было «закодировано» в самых первых живых существах, в их ДНК или РНК, и в условиях среды, где им предстояло эволюционировать.


Индивидуальное развитие многоклеточных организмов далеко не всегда, но довольно часто повторяет («рекапитулирует») отдельные этапы его эволюционной истории. Так получается потому, что мутации, меняющие ранние этапы развития, чаще оказываются вредными и реже — полезными, чем мутации, затрагивающие более поздние этапы. Чем раньше в ходе эволюции появился признак, тем больше вероятность, что какие-то другие жизненно важные признаки организма уже успели стать зависимыми от него («подогнались», «притерлись» к нему под действием отбора), и поэтому он не может быть изменен без ущерба для целого. Напротив, новые признаки часто очень пластичны, потому что все прочие признаки в ходе индивидуального развития формируются независимо от этого нового признака. Поэтому часто самый простой способ для эволюции «создать» новый признак состоит в том, чтобы «пристроить» программу его формирования в самый конец уже имеющейся, устоявшейся программы.

Таким образом, эволюционная теория предсказывает, что в эмбриональном развитии иногда должны воспроизводиться этапы эволюционной истории, а ранние стадии развития зародышей должны быть в тенденции более похожими друг на друга, чем поздние. Эти предсказания хорошо подтверждаются фактами. Антиэволюционизм, напротив, ничего такого не предсказывает, потому что «разумный дизайнер» имел полную возможность разработать уникальную, неповторимую программу индивидуального развития для каждого вида в отдельности. Однако, сравнивая между собой эмбриональное развитие разных животных, мы видим не набор уникальных программ, а поразительное и очень глубокое сходство. Например, даже очень непохожие друг на друга животные проходят практически одинаковые ранние стадии развития: зигота (оплодотворенное яйцо), бластула, гаструла и др. Как и в морфологии (см. раздел «Морфологические доказательства«), в индивидуальном развитии организмов мы видим бесчисленные и несомненные следы «происхождения путем модификации», а вовсе не множества независимых актов творения.

Месячный эмбрион человека при внематочной беременности. Видны зачатки жаберных дуг и хвост.


У всех позвоночных животных наблюдается значительное сходство зародышей на ранних стадиях развития: форма тела, зачатки жаберных дуг, хвост, один круг кровообращения и т. д. (закон зародышевого сходства Карла Максимовича Бэра). Однако по мере развития сходство между зародышами различных систематических групп постепенно стирается и начинают преобладать черты, свойственные их классам, семействам, родам, и, наконец, видам.

Эволюционные изменения могут касаться всех фаз онтогенеза, то есть могут приводить к изменениям не только зрелых организмов, но и эмбрионов, даже на первых этапах развития. Тем не менее, более ранние фазы развития должны отличаться большим консерватизмом, чем более поздние, так как изменения на более ранних этапах развития в свою очередь должны привести к большим изменениям в процессе дальнейшего развития. Например, изменение типа дробления вызовет изменения в процессе гаструляции, равно как и во всех следующих стадиях. Поэтому изменения (мутации), проявляющиеся на ранних этапах, чаще оказываются летальными, чем изменения, касающиеся более поздних периодов онтогенеза.

Таким образом, ранние стадии развития изменяются относительно редко, а значит, сравнительное изучение эмбрионов разных видов может быть источником сведений о степени эволюционного родства.

В 1837 году эмбриолог Карл Райхерт выяснил, из каких зародышевых структур развиваются квадратная и сочленовная кости в челюсти рептилий. У зародышей млекопитающих обнаружены те же структуры, но они развиваются в молоточек и наковальню среднего уха (см.: Н.Н.Иорданский. Эволюция жизни. Глава 3). Палеонтологическая летопись также подтверждает происхождение частей уха млекопитающих из костей челюсти рептилий.

Изучение развития зародышей современных организмов помогает реконструировать ход эволюции и даже позволяет предсказывать, какие палеонтологические находки могут быть сделаны в будущем. Так, у предков зверей — зверозубых рептилий — была только одна слуховая косточка (стремечко), а молоточек (=сочленовная кость) и наковальня (=квадратная кость) образовывали челюстной сустав. То же самое наблюдается и у самых примитивных древних млекопитающих. У современных млекопитающих в ходе эмбрионального развития эти косточки сначала, как и у далеких предков, прилегают к нижней челюсти (на этом этапе они неотличимы от сочленовной и квадратной костей эмбрионов рептилий), а затем отделяются от нее. Отделение происходит в два этапа: сначала слуховые косточки отделяются от боковой поверхности нижней челюсти, но остаются связаны с ней спереди посредством меккелева хряща (этот хрящ, кстати, представляет собой остаток первичной, изначальной нижней челюсти позвоночных; у акул, например, вся нижняя челюсть образована меккелевым хрящом). На втором этапе исчезает и это переднее соединение: меккелев хрящ у взрослых млекопитающих рассасывается. Таким образом, эмбриональное развитие млекопитающих подтверждает выводы сравнительной анатомии о происхождении молоточка и наковальни млекопитающих от костей челюстного сустава рептилий.

На основании этих фактов свыше 30 лет назад была выдвинута гипотеза, согласно которой в эволюции среднего уха млекопитающих должна была быть промежуточная стадия — примерно такая же, как в эмбриональном развитии современных зверей (Allin, E. F. 1975. Evolution of the mammalian middle ear. // J. Morphol. 147, 403–438). Эта гипотеза блестяще подтвердилась в 2007 году, когда в Китае был найден скелет млекопитающего, жившего 125 млн лет назад (в раннемеловую эпоху) и получившего название яноконодон (Yanoconodon allini). Молоточек и наковальня у яноконодона уже отделены от нижней челюсти с боков, но еще прикреплены к ней спереди посредством окостеневшего меккелева хряща (см.: Новая палеонтологическая находка проливает свет на раннюю эволюцию млекопитающих)..

Есть многие другие примеры того, как эволюционная история организма временно проявляется в ходе его развития. У эмбрионов млекопитающих на ранних стадиях есть зачатки жаберных дуг и жаберных мешков, неотличимые по строению от соответствующих зачатков у зародышей водных позвоночных. Это объясняется тем, что предки млекопитающих жили в воде и дышали жабрами. Разумеется, жаберные мешки зародышей млекопитающих в ходе развития превращаются не в жабры, а в структуры, возникшие в ходе эволюции из жаберных щелей или стенок жаберных карманов, такие как евстахиевы трубы, среднее ухо, миндалины, паращитовидные железы и тимус. При этом отчасти сохраняется относительное расположение нервов и кровеносных сосудов, подходивших к жаберным дугам у рыб. Именно поэтому, например, возвратный гортанный нерв у млекопитающих от мозга идет вниз по шее, огибает аорту и возвращается вверх к гортани (см. раздел «Морфологические доказательства«).

Эмбрион кота (слева) и человека (справа) на стадии, когда хорошо видны жаберные дуги, хвост, зачатки передних и задних конечностей. С сайта talkorigins.org


У эмбрионов многих видов змей и безногих ящериц (например, веретеницы ломкой) развиваются зачатки конечностей, но затем они рассасываются. [см. статью о редукции конечностей у рептилий] Аналогично, у китов и дельфинов нет задних конечностей, но у эмбрионов китообразных начинают расти задние ноги, развиваются кости, нервы, сосуды, а затем все эти ткани рассасываются (Amasaki, H., et al. Developmental changes of the fore- and hind-limbs in the fetuses of the southern minke whale, Balaenoptera acutorostrata; Sedmera, D., et al. On the development of Cetacean extremities: I. Hind limb rudimentation in the Spotted dolphin Stenella attenuata)

Дарвин в качестве примера приводил наличие зубов у зародышей усатых китов (Дарвин, 1859. Глава XIV. Рудиментарные, атрофированные и абортивные органы.)

Эмбрион дельфина Stenella attenuata. Видны зачатки передних (f) и задних (h) конечностей. Из первых разовьются плавники, вторые исчезнут. С сайта talkorigins.org


У человеческих эмбрионов на ранних этапах развития (4–5 недель) есть заметный хвост с 10–12 развивающимися хвостовыми позвонками, длина которого составляет более 10 % длины эмбриона (Fallon, J. F., Simandl, B. K. Evidence of a role for cell death in the disappearance of the embryonic human tail). Развиваются не только позвонки, но и спинной мозг, и ряд других структур. К восьмой неделе шесть крайних позвонков отмирают (в результате смерти клеток). 5-й и 4-й хвостовые позвонки уменьшаются, прочие структуры также отмирают и уменьшаются. Макрофаги утилизируют разрушающиеся клетки (Sapunar, D., et al. Morphological diversity of dying cells during regression of the human tail). У взрослых людей остается 4 хвостовых позвонка, которые образуют копчик.

Современные сумчатые и плацентарные млекопитающие живородящи, но их предки были яйцекладущими (подобно современным ехиднам и утконосам). У плацентарных в эмбриональном развитии не осталось явных следов скорлупы или специальных приспособлений для ее пробивания, однако в ходе развития зародышей сумчатых на короткое время возникает и потом рассасывается яичная скорлупа, а у некоторых новорожденных сумчатых (коала, бандикуты и др.) имеется рудиментарный яйцевой зуб (Tyndale-Biscoe, H. and Renfree, M. 1987. Reproductive Physiology of Marsupials).

Любимым аргументом антиэволюционистов является тот факт, что Эрнст Геккель, более ста лет назад нарисовавший свой знаменитый рисунок, демонстрирующий сходство эмбрионов разных классов позвоночных, на самом деле сильно идеализировал реальную картину (что, впрочем, в те времена не считалось таким уж страшным прегрешением — ведь он рисовал просто схему, а схемы всегда идеализированы). Но какое нам дело сейчас, спустя полтора века, до рисунков Геккеля? Они — не более чем исторический курьез, и их неточность никоим образом не влияет на силу и достоверность эмбриологических доказательств эволюции. Посмотрите хотя бы выше на фотографии эмбрионов человека, кота и дельфина. Впрочем, и научная недобросовестность Геккеля вовсе не является доказанным фактом, о чем свидетельствую данные, приведенные в статье R.J.Richards, 2009. Haeckel’s embryos: fraud not proven.

Дополнительный пример 1. Подкласс двусторонне-симметричных «неправильных» морских ежей (Irregularia) произошел от обычных «правильных» радиально-симметричных морских ежей (подкласс Regularia) в юрском периоде. Эволюционный переход от правильных ежей к неправильным, начавшийся около 170 и закончившийся около 145 млн лет назад, детально документирован в палеонтологической летописи (см. А.Н.Соловьев, А.В.Марков. Ранние этапы эволюции неправильных морских ежей). При этом у всех современных неправильных ежей личинка сначала превращается в маленького радиально-симметричного ежика, строение которого во всех основных чертах воспроизводит морфологию правильных морских ежей. В ходе дальнейшего развития постепенно развивается двусторонняя симметрия и все основные отличительные признаки подкласса Irregularia.

«Новорожденные» неправильные морские ежики рода Abatus (сверху) имеют радиальную симметрию и по своему строению в целом соответствуют диагнозу подкласса Regularia. Взрослые Abatus (снизу), как и все представители подкласса Irregularia, имеют двустроннюю симметрию.

Ископаемый морской еж Pygaster (юрский период) — одна из переходных форм между правильными и неправильными морскими ежами. Преобладает радиальная симметрия, но перипрокт (анальное отверстие) уже сильно смещен назад (на фото — вниз), что придает ежу элементы двустронней симметрии. В индивидуальном развитии современных неправильных морских ежей приобретение двусторонней симметрии тоже начинается со смещения перипрокта из центра верхней поверхности в заднем направлении.


Дополнительный пример 2. У взрослых камбалообразных рыб оба глаза находятся на одной стороне головы, а весь череп сильно искривлен и искорежен. У предков камбал, естественно, голова была симметричной, как у всех нормальных рыб. Поэтому неудивительно, что мальки камбал тоже имеют симметричную голову, которая в ходе роста постепенно теряет симметрию, искажается, и один глаз переползает на другую сторону головы. Недавно обнаружены ископаемые переходные формы, доказывающие возможность постепенного эволюционного перехода от «обычных» рыб к камбалообразным. См. в заметке Ископаемые рыбы в очередной раз подтвердили правоту Дарвина


См. также замечательную подборку фактов на англ. языке с сайта talkorigins.org.

Эво-дево: следы макроэволюции

Креационисты нередко признают образование новых видов, но решительно отрицают существование макроэволюции, то есть возникновения таксонов (групп организмов) надвидового ранга. Действительно, трудно спорить с тем фактом, что под действием отбора в популяции могут появиться группы особей, резко различающиеся по множеству мелких признаков, а иногда и утрачивающие способность к скрещиванию между собой. Об этом свидетельствует и богатый опыт селекции растений, животных и микроорганизмов (см. раздел «Изменения видов при доместикации: от искусственного отбора к естественному«), и лабораторные эксперименты, и наблюдения над природными популяциями (см. раздел «Наблюдаемая эволюция«).

Мы легко можем представить себе изменчивость особей одного вида по размерам, форме, окраске (вспомним хотя бы про породы собак), но вот перестройки плана строения организмов, то есть числа, положения и идентичности их органов, для нас не столь уж очевидны. Каким же образом могут возникать глубокие различия в строении или поведении организмов, позволяющие говорить о появлении новых родов, семейств, классов, типов, то есть о макроэволюции? На первый взгляд, происхождение таких крупных новаций кажется неразрешимой загадкой. Для того, чтобы её разгадть, нам надо ответить на три вопроса:

1. Как и почему может измениться план строения организмов?

2. Способны ли организмы, имеющие необычный план строения, выживать и размножаться в природе?

3. Действительно ли известные нам механизмы перестроек плана строения имеют отношение к происхождению надвидовых таксонов, т. е. к макроэволюционным событиям?

Гомеозис и не только

Генетикам давно известны мутации, вызывающие резкие перестройки плана строения организмов, такие как гомеозис (изменение идентичности органов) и гетеротопии (образование обычных органов в несвойственных для них местах). Впервые такая мутация — появление второй пары крыльев у плодовой мушки дрозофилы — была описана К. Бриджесом ещё в 1915 году (она получила название bithorax, см. рисунок). К концу 20 века были подробно изучены гены, регулирующие индивидуальное развитие и формирование отдельных органов у ряда модельных организмов (дрозофилы, мыши, растения арабидопсис и некоторых других). Мутации этих генов и приводят к гомеозисным эффектам, а значит — указывают на возможные причины глубоких морфологических перестроек в эволюции.

Примеры:

Слева: плодовая мушка Drosophila melanogaster (http://www.tmd.ac.jp/artsci/biol/textlife/fruitfly.jpg), один из основных модельных объектов генетики животных. Справа: мутация bithorax у дрозофилы (http://evolution.berkeley.edu/evosite/evo101/IIIC6Development.shtml): превращение третьего сегмента груди в дубликат второго, в результате чего у мухи появляется ещё одна пара крыльев, а также второй желудок.

Мутация antennapedia у дрозофилы (http://fr.academic.ru/dic.nsf/frwiki/112609): вместо усиков (антенн) у мухи формируется пара ног.

Резуховидка Таля (Arabidopsis thaliana), важнейший модельный объект генетики растений, и её цветок.

Слева: мутант Arabidopsis по гену AGAMOUS: у него не образуются тычинки и плодолистики, а сам цветок может ветвиться подобно вегетативному побегу (http://chieffa.livejournal.com/54677.html). Справа: мутант Arabidopsis по гену APETALA1: на месте лепестков у него формируются тычинки, чашелистики превращаются в листьях, а в их пазухах развиваются цветы следующего порядка (http://www.ndsu.edu/pubweb/~mcclean/plsc731/flower/flower2.htm).

Итак, мутации лишь одного гена могут вызвать резкие изменения в строении дрозофилы и арабидопсиса, а значит и других организмов. Впрочем, подобные эффекты могут возникать и без изменения нуклеотидной последовательности гена — достаточно того, чтобы обычный ген заработал (стал экспрессироваться) в необычном месте и/или в необычное время. Иными словами, морфологические перестройки могут быть обусловлены не только генетическими, но и так называемыми эпигенетическими механизмами, связанными с управлением и регуляцией работы генов; примеры таких перестроек будут приведены ниже. Итак, появление организмов с измененным планом строения — это, можно сказать, «дело техники».

2.2. Безнадежны ли «обнадёживающие монстры»?

В 1940 году Рихард Гольдшмидт высказал гипотезу о том, что макроэволюция есть результат системных мутаций (макромутаций), то есть наследственных изменений, затрагивающих всю систему генотипа и несводимых к изменениям отдельных генов. Именно он ввел в обиход яркий образ «обнадёживающего монстра» (hopeful monster), то есть носителя такой макромутации. Долгое время концепция Гольдшмидта находилась на периферии внимания ученых. Интерес к ней оживился лишь в 1990-е годы, а сейчас тема hopeful monsters приобрела научную респектабельность.

Называя носителей эволюционных новаций «монстрами» (хоть и «обнадеживающими»), Гольдшмидт понимал, что этим необычным существам в жизни должно быть нелегко. Речь ведь идет о тяжелых уродствах, которые, как кажется, не оставляют организмам шансов на выживание и размножение. Тем не менее в природе иногда встречаются популяции, в значительной мере состоящие из «монстров», и ученые знают о них очень давно.

Пример 1. Пелории у льнянки.

Льнянка обыкновенная (Linaria vulgaris) — невысокое растение с красивыми желто-белыми цветками, которое нередко можно встретить на пустырях, опушках, на песчанных дюнах и по обочинам дорог. По строению цветков льнянка очень похожа на львиный зев, с которым она состоит в близком родстве. Для них обоих характерны отчетливо двугубые цветки с длинным шпорцем.

В 1742 году Магнус Сёберг (M. Ziöberg), студент из Уппаслы, обнаружил на одном из островов к северо-востоку от Стокгольма заросли льнянки с радиально-симметричными цветками, несущими пять шпорцев. Когда выдающийся ботаник Карл Линней увидел это растение в гербарии, он был настолько поражен, что поначалу даже заподозрил подделку. Тщательная проверка показала, однако, что этот экземпляр был именно льнянкой, но с крайне своеобразными цветками, для которых Линней ввёл специальный термин «пелория» (т. е. по-гречески «монстр»). По его настоянию Сёберг совершил специальную поездку к месту своей находки, доставил оттуда в Уппсалу живые экземпляры странной льнянки, которые были высажены в университетском ботаническом саду. Линней же посвятил пелориям специальную диссертацию, опубликованную в 1744 году.

Пелорический цветок льнянки (http://www.uu.se/linne2007/index.php?option=com_content&task=view&id=51&Itemid=72&lang=en)

Почему же великого ботаника так заинтересовали эти цветки с пятью шпорцами? Прежде всего, находка Сёберга ставила под вопрос принципы той системы растительного царства, которую он разрабатывал. Обычная льнянка попадала в иной класс этой системы, чем льнянка с пелорией, хотя близость этих растений была очевидна.

Рисунок пелории у льнянки из диссертации К. Линнея (рисунок из статьи Gustafsson, 1979)

Но была и более важная причина. Как и его современники, шведский ботаник был последовательным креационистом («Столько насчитываем видов, сколько их изначально создало Бесконечное Существо» — писал он в «Философии ботаники»), но открытие пелорических цветков заставило его задуматься об изменяемости видов. Линней предположил, что такие цветки появляются из-за опыления льнянки чужой пыльцой — и тем самым вынужден был рассмотреть возможность появления в природе нового вида.

Итак, появление пелорических цветков сопряжено с изменением симметрии цветка (от двусторонней к радиальной), а также — с глубокой трансформацией сросшихся лепестков (на каждом из их появляется шпорец). При этом строение цветка приспособлено к определенным опылителям, и перестройки его плана строения влекут за собой рискованные перемены в способах размножения. Обычная льнянка опыляется пчелами; в пелорический же цветок пчела проникнуть не может, и такие «монстры» размножаются только вегетативно. Трудно судить, насколько они «обнадёживающи» в эволюционной перспективе, но факт их выживания в природе налицо.

Львиный зев большой (Antirrhinum majus), ещё один модельный объект генетики развития растений (http://de.academic.ru/dic.nsf/dewiki/86937)

Та популяция на острове близ Стокгольма, в которой Сёберг нашел монструозные цветки, существует и по сей день, что позволяет исследовать этот феномен современными методами. П. Кубас, К. Винсент и Э. Коэн (Cubas, Vincent, Coen, 1999) обнаружили, что пелории у льнянки возникают в результате мутации гена LCYC — близкого по своей структуре и функции к гену CYCLOIDEA, отвечающего за формирование двусторонней симметрии цветков у львиного зева Antirrhinum (модельного объекта, генетика которого изучено гораздо подробнее, чем у льнянки). Чрезвычайно интересно, однако, что такая мутация не связана с изменением последовательности нуклеотидов в гене LCYC — работа этого гена обратимо блокируется путем его метилировования, и эта блокировка передается по наследству. Иными словами, пелорические цветки образуются не в результате «классической» мутации гена как такового, а из-за изменения системы запуска и остановки его работы — то есть вследствие эпигенетической мутации. Мы видим, насколько глубокие изменения строения организмов могут быть обусловлены эпигенетическими механизмами — при этом они обходятся без «порчи» ДНК, о которой так сетуют креационисты.

Литература:

Cubas P., Vincent C., Coen E.. 1999. An epigenetic mutation responsible for natural variation in floral symmetry. Nature. 1999 Sep 9;401 (6749):157–161.

Gustafsson Å. 1979. Linnaeus' Peloria: the history of a monster. Theor. Appl. Genetics 54: 241–248.

Пример 2. Десятитычинковые цветки пастушьей сумки.

Важнейшим модельным объектом генетики растений была и остается резуховидка Таля, более известная под своим научным названием Arabidopsis thaliana. Это невзрачная однолетняя травка, относящаяся к семейству крестоцветные, служит своего рода «растительной дрозофилой»: именно её изучение позволило сформулировать современные представления о механизмах генетического контроля развития растений. Мы уже говорили про некоторые гомеозисные мутации у Arabidopsis; они вполне могут претендовать на эволюционную роль «обнадёживающих монстров». Правда, природные популяции резуховидки, в которых «монстры» встречались бы в заметном количестве, пока неизвестны.

Такие «монструозные» популяции, однако, найдены у пастушьей сумки (Capsella bursa-pastoris), близкого родственника Arabidopsis. Ещё в 1821 году П.М. Опиц (P.M. Opiz) описал необычную форму этого растения, у которой все 4 лепестка преобразовались в тычинки (их, соответственно, стало не шесть, как обычно для крестоцветных, а десять). Позже безлепестные экземпляры (иногда в значительном количестве) были обнаружены на территории ряда европейских стран и в США. Две природных популяции пастушьей сумки вблизи Гау-Одернхайма и Варбурга, в которых преобладают безлепестные формы, обстоятельно изучаются немецкими ботаниками во главе с Г. Тайсеном (G. Theißen).

Соцветия пастушьей сумки с цветками дикого типа (а) и с цветками без лепестков (b) (фото из статьи Hintz et al., 2006).

Утрата лепестков не фатальна для пастушьей сумки, семена которой могут образовываться и после самоопыления. Как показали специальные исследования, безлепестные растения существенно не отличаются по количеству семян от растений дикого типа. Не исключено, однако, что такая гомеозисная мутация может привести к смене опылителей: из-за замены лепестков на тычинки цветок становится менее заметным для пчел, но более привлекательным для жуков и других насекомых, питающихся пыльцой. Вообще говоря, утрата околоцветника — это первый шаг на пути к ветроопылению: такую перспективу для пастушьей сумки исключать тоже нельзя.

Но каков может быть генетический механизм замены лепестков тычинками, наблюдаемой у пастушьей сумки? В поисках ответа на этот вопрос большую помощь оказывают данные по Arabidopsis, у которой механизмы контроля развития цветка изучены очень подробно. Десятитычинковые цветки у резуховидки были получены Т. Джеком с соавторами (Jack et al., 1997) путем экспериментального расширения области экспрессии (то есть активной работы) гена AGAMOUS (отвечающего за формирование тычинок и плодолистиков) на ту зону формирующегося цветка, на которой обычно располагается венчик. Вероятно, подобный механизм действует и у пастушьей сумки: эта гипотеза (а также ряд других предположений) проверяются сейчас группой Г. Тайсена.

Литература:

Hintz M, Bartholmes C., Nutt P., Ziermann J., Hameister S., Neuffer B., G. Theißen. 2006. Catching a ‘hopeful monster’: shepherd’s purse (Capsella bursa-pastoris) as a model system to study the evolution of flower development. J. Exp. Bot. 57 (13): 3531–3542.

Nutt P., Ziermann J., Hintz M, Neuffer B., G. Theißen. 2006. Capsella as a model system to study the evolutionary relevance of floral homeotic mutants. Plant Syst. Evol. 259:217–235.

Монстры и макроэволюция

Предположим, что некая мутация, случившаяся десятки миллионов лет назад, привела к появлению вполне жизнеспособного «монстра». Но как нам доказать, это этот «монстр» стал родоначальником нового надвидового таксона? Заглянуть в прошлое и реконструировать ход событий на уровне генов позволяют методы молекулярной филогенетики вкупе с генетикой развития. Сопоставляя признаки разных организмов с информацией о структуре и работе генов, регулирующих их индивидуальное развитие, ученые могут строить и проверять модели, объясняющие механизмы возникновения крупных новаций. Этот подход лежит в основе нового научного направления — эволюционной генетики развития, часто называемой «эво-дево» (evo-devo). Рассмотрим его на примерах.

Пример 1. Двусторонняя симметрия цветков Iberis.

Для Arabidopsis, пастушьей сумки и подавляющего большинства других представителей семейства крестоцветных характерны цветки с лучевой симметрией венчика. Все 4 лепестка у них одинаковы по форме и размерам, и располагаются они под прямым углом друг к другу. У растений рода Iberis (иберис или стенник), однако, мы встречаем цветки с отчетливой двусторонней симметрией: два верхних лепестка у них заметно мельче, чем два нижних. Какие же причины привели к появлению таких цветков — и как нам доказать их эволюционную преемственность с цветками других крестоцветных?

Сверху: радиально-симметричные цветки резуховидки Таля (Arabidopsis thaliana) Снизу: двусторонне-симметричные цветки ибериса (Iberis amara)


Чтобы ответить на этот вопрос, нужно найти ген или гены, отвечающие за формирование двусторонне-симметричного венчика у Iberis. Ближайший модельный объект, по аналогии с которым можно было бы искать такие гены — это, конечно же, Arabidopsis. У него, однако, неизвестны мутации, приводящие к появлению двусторонне-симметричных цветков, а значит и гены, которые можно заподозрить в причастности к этому. Такие гены — CYCLOIDEA (CYC) и DICHOTOMA (DICH) — хорошо изучены у львиного зева Anthyrrhinum (про первый из них уже шла речь в примере с пелорическими цветками льнянки). Этот модельный объект не состоит в тесном родстве с Iberis, но именно он дал ключ к дальнейшим поискам.

Геном Arabidopsis полностью расшифрован, и в нем найден только один ген, имеющий сходную последовательность с CYC львиного зева. Этот ген, названный TCP1, в норме заметно не влияет на строение цветка резуховидки. Можно предположить, однако, что у Iberis тоже есть TCP1-подобный ген, и именно он определяет формирование двусторонней симметрии у венчика. А. Буш и С. Цахго (Busch & Zachgo, 2007) проверили эту гипотезу и подтвердили её.

У Iberis был выделен ген IaTCP1, очень близкий по своей последовательности гену TCP1 Arabidopsis. Этот ген включается на поздних этапах формирования цветка, вызывая активное деление клеток в зачатках двух нижних лепестков и, соответственно, их быстрое увеличение в размерах. В отличие от Iberis, ген TCP1 у Arabidopsis (как и CYC у львиного зева) экспрессируется на самых ранних стадиях развития цветка, когда зачатки лепестков только-только начинают формироваться. Таким образом, появление двусторонне-симметричных цветков Iberis есть результат изменения места и, главное, времени включения уже имеющегося гена.

Данный пример показывает, что весьма крупное новшество в строении цветка, позволившее выделить Iberis в самостоятельный род, возникло не ex nihilo. Если допустить версию о независимом творении этого рода, останется непонятным, почему ген IaTCP1 столь похож по своей структуре на TCP1 Arabidopsis, а они оба могут быть выявлены по сходству с CYC-подобными генами львиного зева. Конечно, мы не могли пронаблюдать сам процесс возникновения Iberis, но дошедшие до нас следы этого события недвусмысленно указывают на преемственность между этим родом и другими группами крестоцветных.

Литература

Busch A., Zachgo S. 2007. Control of corolla monosymmetry in the Brassicaceae Iberis amara. PNAS 104 (42): 16714-16719.

Пример 2. Почему у орхидей такие разнообразные цветки?

Семейство орхидные (Orchidaceae) — второе по величине среди цветковых растений. Оно насчитывает около 30 тысяч видов, поражающих разнообразием и изысканностью своих цветков. За их красотой, однако, стоит суровая утилитарность: цветок орхидеи приспособлен для опыления строго определённым опылителем (60 % видов орхидей опыляются лишь одним видом животных, главным образом насекомых). Но почему именно у орхидных (а не у лилейных, например) появлось такое разнообразие цветков? Ответ на этот вопрос дают недавние работы М. Мондрагон-Паломино с соавторами (Mondragón-Palomino & Theißen, 2008, 2009; Mondragón-Palomino, 2009), проливающие свет и на происхождение этого огромного семейства.

При всем своем разнообразии цветки орхидей имеют сходный план строения: как правило, их трудно перепутать с цветками растений из других семейств. Для подавляющего большинства орхидей характерна отчетливая двусторонняя симметрия цветка. Околоцветник всегда состоит из шести элементов, расположенных в два круга по три. Обычно листочки наружного круга околоцветника (иногда неверно называемые «чашелистиками») примерно одинаковы по форме и размерам (T1-T3 на схеме внизу), в то время как средний элемент внутреннего круга (t3, губа) как правило резко отличается от двух боковых листочков (t1 и t2). Губа играет важную роль во взаимодействии с опылителем, а потому её строение бывает особенно замысловатым.

Схема строения околоцветника орхидей на примере Dendrobium cariniferum (из статьи Mondragón-Palomino & Theißen, 2008)

Сверху: радиально-симметричный цветок у Spiloxene serrata, представителя семейства гипоксиевые (Hypoxidaceae) из Южной Африки. Снизу: симметрия цветка орхидей Apostasia wallichii (подсемейство Apostasioideae) из Новой Гвинеи близка к радиальной (http://www.orchidspecies.com/apostwallichii.htm).

Орхидеи: ваниль (Vanilla planifolia, подсемейство Vanilloideae) из тропиков Нового Света (http://www.dragonagro.com/wholesale_orchids.htm); Венерин башмачок (Cypripedium calceolus, подсемейство Cypripedioideae), Ленинградская область; ятрышник шлемоносный (Orchis militaris, подсемейство Orchidoideae), Ленинградская область; дремлик болотный (Epipactis palustris, подсемейство Epidendroideae), Ленинградская область.


Ближайшим родственником орхидных является семейство гипоксиевые (Hypoxidaceae); к нему относятся травянистые растений с радиально-симметричными цветками. Само же семейство Orchidaceae состоит из пяти подсемейств: Apostasioideae (небольшая группа орхидей, встречающихся в Непале, Японии, Китае, Новой Гвинее и Австралии), Vanilloideae (например, ваниль), Cypripedioideae (сюда относится венерин башмачок), Orchidoideae (например, ятрышник или любка) и Epidendroideae (80 % видов орхидей, в их числе дремлик, гнездовка, тайник и др.). Эти подсемейства отчетливо различаются по особенностям цветка; кроме того, их выделение подтверждено данными молекулярной филогенетики. Среди них подсемейство Apostasioideae — явно самое древнее и примитивное: венчик у его представителей почти радиально-симметричный, есть и ряд других архаичных особенностей.

Родственные связи между Hypoxidaceae и подсемействами орхидных (из статьи Mondragón-Palomino & Theißen, 2008). Филогенетическое дерево, построено путем анализа последовательностей ДНК нескольких пластидных генов (rbcL, matK, atpB), взятых у большого числа видов из всех перечисленных семейств и подсемейств. Хотя эти гены не имеют отношения к развитию цветка, полученная на их основе схема родственных связей хорошо согласуется с имеющимися представлениями об эволюции этого органа у орхидных, в частности — с тенденцией к переходу от радиальной к двусторонней симметрии околоцветника.


У всех изученных цветковых растений в регуляции образования околоцветника участвуют так называемые гены В-класса, подобные генам DEFICIENS (DEF) и GLOBOSA (GLO) львиного зева (им соответствуют APETALA3 и PISTILLATA у Arabidopsis). Мы не будем обсуждать АВС-модель и более современные концепции, объясняющие работу этих генов (подробности можно посмотреть здесь или здесь). Нам важно лишь отметить, что у многих растений имеется только один DEF-подобный и один GLO-подобный ген, которые и обеспечивают формирование у них нормальных цветков.

У орихидных, однако, дело обстоит гораздо интереснее. Как обнаружила М. Мондрагон-Паломино и её коллеги, у них есть целых четыре DEF-подобных гена, и каждый из них выполняет свою функцию. Условно говоря, гены 1 и 2 определяют, что органы, формирующиеся под их контролем, станут именно листочками околоцветника, а не листьями, тычинками или плодолистиками; ген 3 задаёт отличия элементов внутреннего круга околоцветника от наружного, а ген 4 отвечает за образование губы и ее отличия от боковых листочков. Столь сложная система регуляции и обеспечивает разнообразие морфогенетических возможностей для цветков орхидных. Мы видим, в частности, что за формирование губы у орхидей отвечает спецальный ген: не случайно некоторые морфологи трактовали эту часть околоцветника как совершенно особый орган.

Четыре DEF-подобных гена обнаружены у представителей всех четырех подсемейств орхидных (Vanilloideae, Cypripedioideae, Orchidoideae и Epidendroideae), исследованных М. Мондрагон-Паломино. У гипоксиевых же найдены только два таких гена, причем один из них близок по структуре к генам 1 и 2 у орхидей, а другой — к их генам 3 и 4. Эти данные показывают, что у предков орхидных произошло два цикла удвоения DEF-подобных генов с последующим «разделением труда» между получившимися копиями. Вероятно, такое удвоение и стало той ключевой инновацией, которая предопределила нынешнее разнообразие и эволюционный успех орхидных.

Четыре DEF-подобных гена орхидных сравнительно сильно различаются между собой по нуклеотидным последовательностям. Это неудивительно — ведь их функции различны. Важно другое: если методами молекулярной филогенетики проанализировать последовательности любого из этих генов (скажем, 1 или 3), взятые у представителей различных подсемейств орхидных, то получатся практически одинаковые филогенетические деревья, совпадающие с деревом на рисунке, приведенном выше.

Таким образом, М. Мондрагон-Паломино и её соавторы обосновали биологически осмысленную модель происхождения и эволюции крупной и своеобразной группы растений. Эта модель демонстрирует преемственность между DEF-подобными генами гипоксиевых и орхидных, хорошо согласуется с данными как сравнительной анатомии цветка, так и с результатами молекулярно-филогенетического анализа. Мы видим, что убедительный сценарий крупного макроэволюционного события — каковым, безусловно, было появление орхидных — совершенно не нуждается в привлечении каких-либо сверхестественных факторов.

Впрочем, мы пока ничего не знаем про гены, регулирующие формирование околоцветника у Apostasioideae, самой примитивной группы орхидных. Очень интересно, сколько DEF-подобных генов окажется у них. На основе имеющегося эволюционного сценария можно предположить, что этих генов окажется либо два (как у гипоксиевых), либо четыре (как у остальных орхидных), либо три (ведь апостасиевые вполне могут рассматриваться как переходная группа между двумя семействами), но никак не один и не больше четырех. Время делать ставки!

Литература:

Mondragón-Palomino M., Theißen G. 2008. MADS about the evolution of orchid flowers. Trends in Plant Science 13 (2): 51–59.

Mondragón-Palomino M., Theißen G. 2009. Why are orchid flowers so diverse? Reduction of evolutionary constraints by paralogues of class B floral homeotic genes. Annals of Botany, advanced online access, Jan 13 2009.

Mondragón-Palomino M., L. Hiese, A. Härter, M.A. Koch, and G. Theiβen. 2009. Positive selection and ancient duplications in the evolution of class B floral homeotic genes of orchids and grasses. BMC Evolutionary Biology 9:80

6. Молекулярно-генетические и биохимические доказательства

Открытия молекулярной генетики блестяще подтвердили факт эволюции

Дарвин опубликовал «Происхождение видов» почти за 100 лет до расшифровки структуры ДНК. Новые знания, полученные с тех пор, могли бы однозначно опровергнуть эволюционное учение, если бы оно было ложно. Вместо этого анализ ДНК дает нам убедительнейшие доказательства теории эволюции. Сам факт наличия наследственной изменчивости необходим для эволюции, и если бы оказалось, что ДНК устойчива к изменениям, это означало бы конец теории. Но ДНК постоянно мутирует, порождая генетическое разнообразие, которое служит материалом для отбора. При этом обычно чем больше генетических различий между организмами, тем сильнее различается и их строение (хотя это не строгое правило, поскольку многие генетические мутации не проявляются в фенотипе). Например, отличия генома человека от генома шимпанзе включают 35 миллионов замен отдельных нуклеотидов, 5 миллионов удалений и вставок, слияние двух хромосом и девять хромосомных инверсий. Это очень небольшая степень различия (порядка 1–2 %), учитывая, что размер генома человека и шимпанзе — свыше 3 миллиардов пар нуклеотидов. Все типы мутаций, которые привели к возникновению этих различий, наблюдаются и сегодня у разных организмов как в природе, так и в лаборатории; в противном случае версию об эволюционном происхождении от общего предка пришлось бы пересматривать, то есть это еще один пример фальсифицируемости теории эволюции.

Расшифровка молекулярной основы наследственности (ДНК) и генетического кода на самом деле была важнейшим «моментом истины» в истории эволюционного учения. «Вещество наследственности» вполне могло оказаться разным у разных видов (например, у человека — ДНК, а у шимпанзе — какой-нибудь другой биополимер). Генетический код тоже мог оказаться разным. В обоих случаях эволюционное превращение одного вида в другой, как и их происхождение от общего предка, стало бы принципиально невозможным, и эволюционная теория была бы опровергнута. Но и «вещество наследственности» (полинуклеотиды ДНК и РНК), и генетический код оказались одинаковыми у всех без исключения форм жизни — от вирусов и бактерий до человека включительно. Правда, в генетическом коде изредка встречаются вариации (см.: Генетический код допускает разночтения), но они очень невелики и обычно затрагивают только некоторые второстепенные, «избыточные» кодоны. Эволюционная теория четко объясняет, почему генетический код практически не может изменяться в ходе эволюции. Чисто «технически» радикальное изменение генетического кода осуществить легко и просто: достаточно внести несколько десятков мутаций в гены транспортных РНК — молекул, играющих ключевую роль в «считывании» кода. В результате, например, «триптофановая» тРНК, распознающая кодон УГГ и присоединяющая к синтезируемой молекуле белка аминокислоту триптофан, начнет распознавать другой кодон или кодоны, например АГГ и АГА, которые сейчас кодируют аргинин. Но в результате этой простой мутации произойдет радикальное изменение всех белков, синтезируемых клетками организма: во всех белковых молекулах там, где должен быть аргинин, окажется триптофан. Такое изменение, затронувшее сразу все белки, не может не оказаться чрезвычайно вредным для организма. Соответственно, такая мутация немедленно будет отсеяна отбором. Антиэволюцинизм, напротив, не может предложить никаких внятных объяснений наблюдаемого единства генетического кода у всех организмов. Творец вполне мог бы снабдить разные виды сотворенных им существ разными генетическими кодами — ну хотя бы для того, чтобы не вводить биологов во искушение, предоставляя им еще один чрезвычайно весомый довод в пользу эволюции. К тому же это было бы и полезно для организмов, так как предотвратило бы межвидовую передачу болезнетворных вирусов. Именно таким путем человек «обзавелся» вирусами оспы (от рогатого скота), СПИДа (от обезьян), гриппа и др. Чисто «технически» разные варианты кода совершенно равнозначны и работать смогли бы одинаково хорошо.

Различия между геномами видов должны соответствовать не только экспериментально наблюдаемым типам мутаций, но и филогенетическому дереву, и палеонтологической летописи. Подобно тому, как анализ ДНК позволяет установить степень родства между двумя людьми, тот же самый анализ ДНК (сравнение отдельных генов или целых геномов) позволяет выяснить степень родства между видами, а зная количество накопленных различий, исследователи определяют время расхождения двух видов, то есть время, когда жил их последний общий предок. Например, согласно данным палеонтологии, общий предок человека и шимпанзе жил примерно 6 миллионов лет назад (такой возраст имеют, например, ископаемые находки оррорина и сахелантропа — форм, морфологически близких к общему предку человека и шимпанзе). Для того, чтобы получилось наблюдаемое число различий между геномами, на каждый миллиард нуклеотидов должно было приходиться в среднем 20 изменений за одно поколение. Сегодня у людей скорость мутаций составляет 10–50 изменений на каждый миллиард нуклеотидов за одно поколение (Giannelli, F., Anagnostopoulos, T., Green, P. M. Mutation rates in humans. II. Sporadic mutation-specific rates and rate of detrimental human mutations inferred from hemophilia B.), то есть данные палеонтологии согласуются с результатами анализа ДНК, в строгом соответствии с теорией эволюции (см. материал Genetic rates of change из архива TalkOrigins.org.)

Для того, чтобы построить филогенетическое дерево, достаточно рассмотреть несколько генов, присутствующих у всех организмов, которые мы хотим включить в это дерево (обычно чем больше генов, тем статистически достовернее получаются элементы дерева — порядок ветвления и длины ветвей).

Особый интерес представляют случаи, когда различия геномов оказываются нейтральными, то есть не влияют на организм. Например, было рассчитано, что цитохром c может быть составлен как минимум 2.3 * 1093 разными способами за счет того, что одинаковую по функции и биологически значимым свойствам молекулу белка можно получить с помощью разных последовательностей аминокислот. В свою очередь, каждая из этих последовательностей может быть закодирована 1046 различными последовательностями ДНК вследствие избыточности генетического кода (разные тройки нуклеотидов кодируют одну и ту же аминокислоту). Нет никаких априорных причин, кроме происхождения от общего предка, по которым два разных вида должны были бы иметь хотя бы отдаленно похожие последовательности ДНК для кодирования нормально работающего (функционального) цитохрома c. То же самое справедливо и для других белков. Тем не менее аминокислотные последовательности большинства белков у близкородственных видов (например, у шимпанзе и человека), как правило, очень похожи. Так, подавляющее большинство гомологичных белков человека и шимпанзе различаются лишь на 1–2 аминокислоты или не различаются вовсе. Различий в нуклеотидных последовательностях обычно больше за счет незначимых, или синонимичных (не влияющих на аминокислотную последовательность белка) нуклеотидных замен.

По соотношению несинонимичных и синонимичных нулеотидных замен (dN/dS) можно определить, насколько сильно действует на данный ген «очищающий» отбор, отбраковывающий мутации, которые меняют свойства белка. Как правило, чем консервативнее (постояннее) функция белка, тем ниже этот показатель. Повышение dN/dS свидетельствует о положительном отборе, т. е. о закреплении полезных мутаций. Например, повышенное значение dN/dS у человека по сравнению с другими млекопитающими зафиксировано в гене FOXP2, который связан со способностью к произнесению членораздельных звуков (см.: Будут ли расшифрованы генетические основы разума?; «Ген речи» FOXP2 оказался регулятором высокого уровня).

Малое число различий в аминокислотных последовательностях белков у близких видов связано не только с тем, что эти различия еще не успели накопиться, но и с тем, что многие одинаково удачные для выполнения данной функции аминокислотные последовательности (см. выше) отделены друг от друга так называемыми «ямами в ландшафте приспособленности». Это значит, что для того, чтобы перейти от одной такой последовательности к другой, функционально равнозначной, нужно приобрести сразу несколько мутаций, каждая из которых по отдельности может снижать функциональность белка. Многие из этих «ям» можно обойти, последовательно приобретая ряд нейтральных мутаций, но это долгий процесс, основанный на случайностях, а не на позитивном отборе, и поэтому он занимает много времени (см.: The Molecular Sequence Evidence из архива TalkOrigins.org.)

Пример сравнения нуклеотидных и аминокислотных последовательностей человека и шимпанзе

Сравнительный анализ нуклеотидных последовательностей позволяет судить о степени родства сравниваемых организмов. Это обстоятельство широко применяется на практике (в частности, для установления отцовства). Например, недавно на основе анализа ДНК из человеческих костей, обнаруженных под Екатеринбургом, удалось доказать, что это останки семьи последнего российского императора Николая II. При этом для сравнения был использован генетический материал ныне живущих родственников царской семьи (см.: Генетический анализ показал, что из детей Николая II не спасся никто).

Изучая семьи с известной генеалогией, генетики оценивают скорость накопления различий в ДНК. В частности, большую помощь оказало исследование ДНК населения Исландии — уникальной страны, где каждый житель знает всех своих предков вплоть то первых колонистов, прибывших в Исландию из Норвегии в IX веке (причем из останков нескольких первопоселенцев тоже удалось извлечь ДНК для анализа). Теми же методами можно реконструировать историю целых народов или, к примеру, находить среди современных азиатов потомков Чингисхана. Результаты генетического анализа при этом хорошо согласуются с сохранившимися историческими сведениями. В ходе многочисленных исследований такого рода, где можно было непосредственно сравнить генетические данные с историческими, генетики раз за разом убеждались в достоверности оценок родства на основе сравнения ДНК, а используемые методы развивались и совершенствовались.

Поэтому сегодня мы имеем возможность при помощи этих многократно проверенных и «откалиброванных» методов оценивать степень родства и таких организмов, по которым у нас нет прямых исторических данных. Результаты таких исследований позволяют устанавливать степень родства различных видов живых организмов с такой же степенью надежности, как и в случае установления отцовства или идентификации останков царской семьи. В частности, наше близкое родство с шимпанзе записано в наших геномах, можно сказать, аршинными буквами.

Рассмотрим пример сравнения нуклеотидных последовательностей ДНК и аминокислотных последовательностей белка у человека и шимпанзе.


Аминокислоты M T P T R K I N P L M K L I N H S F I D

Нуклеотиды ATGACCCCGACACGCAAAATTAACCCACTAATAAAATTAATTAATCACTCATTTATCGAC 60 шимпанзе

|||||||| | |||||||| |||||| ||||||||||||||||| |||||||| ||||||

ATGACCCCAATACGCAAAACTAACCCCCTAATAAAATTAATTAACCACTCATTCATCGAC 60 человек

M T P M R K T N P L M K L I N H S F I D


L P T P S N I S A W W N F G S L L G A C

CTCCCCACCCCATCCAACATTTCCGCATGATGGAACTTCGGCTCACTTCTCGGCGCCTGC 120

|||||||||||||||||||| ||||||||||| |||||||||||||| || |||||||||

CTCCCCACCCCATCCAACATCTCCGCATGATGAAACTTCGGCTCACTCCTTGGCGCCTGC 120

L P T P S N I S A W W N F G S L L G A C


L I L Q I T T G L F L A M H Y S P D A S

CTAATCCTTCAAATTACCACAGGATTATTCCTAGCTATACACTACTCACCAGACGCCTCA 180

|| ||||| ||||| ||||||||| |||||||||| || |||||||||||||||||||||

CTGATCCTCCAAATCACCACAGGACTATTCCTAGCCATGCACTACTCACCAGACGCCTCA 180

L I L Q I T T G L F L A M H Y S P D A S


Здесь показан начальный фрагмент (180 нуклеотидов) митохондриального гена цитохрома b шимпанзе и человека. Митохондриальные гены накапливают мутации примерно в 5-10 раз быстрее, чем ядерные. Поэтому митохондриальные гены человека и шимпанзе различаются на 9 %, а ядерные — где-то на 1–2 %. Здесь показан митохондриальный ген, потому что если бы мы взяли ядерный ген, сходство было бы очень большим, и нам пришлось бы приводить гораздо более длинную последовательность, чтобы наглядно продемонстрировать характер различий. А вообще ген можно взять практически любой — картина будет качественно одна и та же.

Из 60 аминокислот, кодируемых этими 180 нуклеотидами, у шимпанзе и человека различаются только две (4-я и 7-я, выделены красным). Из 60 кодонов (триплетов, троек нуклеотидов) различаются 16, однако только 2 из 16 различий являются «значимыми» (несинонимичными), а остальные — синонимичные, не влияющие на структуру белка. Синонимичные нуклеотидные отличия человека от шимпанзе веделены зеленым цветом и подчеркиванием, несинонимичные — красным цветом и подчеркиванием.

Генетическое родство человека и шимпанзе доказывается даже не столько сходством последовательностей, сколько характером различий между ними. Легко заметить, что характер этих различий полностью соответствует предсказаниям эволюционной теории. Больше всего должно быть синонимичных нуклеотидных замен, потому что такие замены не влияют на свойства белка и, следовательно, невидимы для отбора, не отбраковываются им. Именно это мы и наблюдаем.

То, что в большинстве случаев (44 из 58) для кодирования одной и той же аминокислоты в геноме человека и шимпанзе используется один и тот же триплет — это еще одно доказательство генетического родства. С точки зрения функциональности нет абсолютно никакой разницы, каким из нескольких триплетов, соответствующих данной аминокислоте, закодировать ее в каждом конкретном случае. Например, аминокислота T (треонин) кодируется любым из четырех кодонов: ACA, ACT, ACG, ACC. Эта аминокислота встречается в одинаковых позициях в рассматриваемом фрагменте белка человека и шимпанзе четырежды. При этом в каждом из четырех случаев она закодирована у обоих видов одним и тем же кодоном (в первых трех случаях это кодон ACC, в четвертом — ACA). Вероятность случайности такого совпадения 0.254 = 0.0039. Если собрать все такие случаи по геномам человека и шимпанзе, вероятность случайности получится невообразимо ничтожной, практически неотличимой от нуля.

Таким образом, дело здесь не просто в сходстве ДНК, дело в характере сходства, которое выходит далеко за пределы любой функциональной оправданности. Особенно важно сходство по бессмысленным частям генетического «текста» (сюда относится и использование одинаковых синонимичных кодонов), а также по характерным ошибкам в нем (см. ниже об эндогенных ретровирусах и псевдогенах). Для любого специалиста по сравнительной геномике кровное родство человека и шимпанзе абсолютно очевидно и не вызывает даже тени сомнения. Опытный учитель сразу поймет, что один ученик бездумно списал у другого, если заметит в их сочинениях не только одинаковые мысли (это еще можно объяснить одинаковыми намерениями авторов), но и одинаковые фразы, используемые для их выражения, а особенно — одинаковые ошибки и одинаковые сорные словечки в одних и тех же местах текста. Все эти бесспорные признаки единства происхождения (а не независимого сотворения) в величайшем изобилии присутствуют в геномах близкородственных видов, каковыми являются человек и шимпанзе.

Сравним теперь аминокислотные последовательности того же самого фрагмента цитохрома b у шимпанзе, человека и макаки резуса:

Pan MTPTRKINPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFLAMHYSPDAS

Homo MTPMRKTNPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFLAMHYSPDAS

Macaca MTPMRKSNPILKMINRSFIDLPAPPNLSMWWNFGSLLAACLILQIITGLLLAMHYSPDTS

Как видим, у макаки аминокислотная последовательность этого белка сильнее отличается от человеческой и шимпанзиной, чем последовательности первых двух видов друг от друга (14 аминокислотных различий между макакой и шимпанзе, 13 — между макакой и человеком, 2 — между шимпанзе и человеком). Это полностью соответствует биологической систематике и эволюционному дереву (шимпанзе — гораздо более близкий родственник человека, чем макака). То, что по одной аминокислоте (4-й) макака больше похожа на человека, чем на шимпанзе, означает, что, скорее всего, у общего предка макаки и человекообразных в этой позиции стояла аминокислота M, которая сохранилась у макаки и человека. Однако в линии шимпанзе, уже после ее отделения от человеческой линии, произошла замена M на T.

Интересно взглянуть на ситуацию с точки зрения шимпанзе. Для этого вида человек — более близкий родственник, чем любая другая обезьна. Даже горилла, внешне не так уж сильно отличающаяся от шимпанзе (по крайней мере на наш человеческий взгляд), приходится шимпанзе более дальней родственницей, чем человек. В свою очередь, для гориллы люди и шимпанзе — самые близкие родственники, значительно более близкие, чем любые другие обезьяны.

Таким образом, результаты сравнения генов и белков подтверждают представления о родственных связях между видами (эволюционном дереве), которые сложились задолго до «прочтения» геномов. Аналогичные результаты получаются при сравнении практически любых генов в любых группах организмов. Каждый читатель может убедиться в этом самостоятельно, поскольку все прочтенные гены и программное обеспечение для их анализа находятся в свободном доступе.

Биохимическое единство жизни

Носителем наследственной информации во всех клетках являются молекулы ДНК, у всех известных организмов в основе размножения — репликация этой молекулы. В ДНК всех организмов используются 4 нуклеотида (аденин, гуанин, тимин, цитозин), хотя в природе встречаются не менее 102 различных нуклеотидов. Кроме того, в природе встречается 390 различных аминокислот, но белки всех организмов составляются из одного и того же набора, в котором всего 20 «основных» аминокислот и пара «дополнительных». При этом возможно 1.4 * 1070 различных информационно эквивалентных генетических кодов, использующих те же самые кодоны и аминокислоты.

Как уже говорилось, если не учитывать эволюционное происхождение всех организмов от общего предка, то ничто не мешает каждому виду иметь собственный генетический код. Такое положение вещей было бы крайне выгодным, так как при этом исключалось бы преодоление вирусами межвидовых барьеров. Тем не менее, ничего подобного не наблюдается, и теория эволюции исключает такую возможность (см. выше).

Ученые, открывшие устройство генетического кода в 50-х и 60-х годах, в своих исследованиях активно использовали предположение, что код практически универсален. Эти ученые (Фрэнсис Крик, Сидней Бреннер, Георгий Гамов и другие) сделали это предположение исходя из версии об эволюционном происхождении от общего предка, не имея никаких прямых доказательств универсальности кода. Полагаясь на универсальность кода, Бреннер в 1957 году пришел к выводу о неперекрываемости кода (один и тот же нуклеотид не может входить одновременно в состав двух или более триплетов) (Brenner, S. (1957) «On the impossibility of all overlapping triplet codes in information transfer from nucleic acid to proteins.»). Работа имела большое значение, так как до нее большинство исследователей считали код перекрывающимся.

В 1961 году, за пять лет до открытия устройства кода, Фрэнсис Крик сослался на работу Бреннера в статье «Общая природа генетического кода для белков». Основываясь на эволюционном предсказании об универсальности кода (в частности — на предположении о том, что у бактерий, табака и людей код устроен одинаково), Крик установил такие важнейшие свойства генетического кода, как триплетность (значащей единицей кода является сочетание трёх нуклеотидов — триплет, или кодон), неперекрываемость и наличие «стартовых» кодонов, с которых начинается чтение информации.

Единство генетического кода широко используется в биотехнологии. Например, бактериям встраивают ген человека, отвечающий за выработку инсулина, и бактерии начинают синтезировать человеческий гормон.

Также можно отметить крайне похожие пути метаболизма в клетках всех организмов. Так, гликолиз у всех эукариот и у большинства прокариот проходит за 10 одинаковых шагов, в одной и той же последовательности, с использованием одних и тех же десяти ферментов (при том что возможны тысячи различных, но термодинамически эквивалентных путей гликолиза). У всех изученных видов основным переносчиком энергии в клетке является аденозинтрифосфат (АТФ), хотя на эту роль могли бы претендовать сотни других молекул (см.: The fundamental unity of life из архива TalkOrigins.org).

2-я хромосома человека

После слияния двух хромосом остаются характерные следы: остатки теломер и рудимертарная центромера.

У всех человекообразных обезьян по 24 хромосомы, за исключением людей, у которых лишь 23 хромосомы. Человеческая 2-я хромосома является результатом слияния двух хромосом предков (Alec MacAndrew. Human Chromosome 2 is a fusion of two ancestral chromosomes).

Доказательства слияния основываются на следующих фактах:

• Хромосома человека соответствует двум хромосомам обезьян. Ближайший человеческий родственник, бонобо, имеет практически идентичные находящимся 2-й хромосоме человека последовательности ДНК, но они расположены на двух отдельных хромосомах. То же самое верно и для более дальних родственников: гориллы и орангутана (см.: Comparison of the Human and Great Ape Chromosomes as Evidence for Common Ancestry)

• На хромосоме человека имеются рудиментарные центромеры. Обычно хромосома имеет только одну центромеру, но на длинном плече 2-й хромосомы наблюдаются остатки второй.

• Кроме того, на хромосоме человека имеются рудиментарные теломеры. Обычно теломеры находятся только на концах хромосомы, но последовательности нуклеотидов, характерные для теломер, наблюдаются ещё и в середине 2-й хромосомы.

2-я хромосома, таким образом, представляет собой убедительное доказательство эволюционного происхождения людей и других обезьян от общего предка.

Эндогенные ретровирусы

Эндогенные ретровирусы представляют собой следы древних вирусных инфекций в ДНК. Ретровирусы (такие как ВИЧ и Т-лимфотропный вирус человека, вызывающий лейкоз и лимфому) встраивают собственный геном в геном клеток зараженного организма. Обычно после этого клетка начинает продуцировать новые копии вируса. В этом процессе возможны сбои: копирование встроенной вирусной последовательности подавляется клеткой хозяина. Сама вирусная последовательность остается в структуре хромосомы. Если вирус встроился в геном стволовой половой клетки, то встроенную вирусную последовательность могут унаследовать потомки инфицированной особи. Ретровирусы встраиваются в геном случайным образом, вероятность независимой встройки одинаковых вирусов на одинаковые позиции у двух разных организмов пренебрежимо мала. А значит, встроенный геном одного и того же ретровируса может присутствовать у двух животных на одной и той же позиции в ДНК только в том случае, если эти животные произошли от общего предка.

Около 1 % человеческого генома занимают эндогенные ретровирусы, всего таких последовательностей в ДНК каждого человека около 30000 (Е. Д. Свердлов Retroviruses and primate evolution). Некоторые из этих ретровирусов встречаются только у человека. Другие последовательности встречаются только у шимпанзе и у человека, причем в одних и тех же позициях в геноме (тем самым подтверждается происхождение человека и шимпанзе от одного предка). Также есть последовательности, встречающиеся у горилл, шимпанзе и человека, у орангутанов, горилл, шимпанзе и человека, и так далее (см.: Endogenous retroviruses из архива TalkOrigins.org). Распределение эндогенных ретровирусов в точности соответствует филогенетическому дереву. См. также: Предки человека заимствовали полезные гены у вирусов

Также можно привести пример из семейства кошачьих. У малых кошек (точнее — у таких животных, как камышовый кот, европейская лесная кошка, степная кошка и домашняя кошка) найдена общая ретровирусная вставка. Ни у каких других хищников этот ретроген не обнаружен.

Антиэволюционистам практически нечего возразить на совершенно убийственный для них «аргумент от эндогенных ретровирусов». Иногда они пытаются утверждать, что эндогенные ретровирусы якобы выполняют полезные функции в геноме многоклеточных организмов, и этим якобы объясняется их присутствие в одних и тех же местах генома у человека и шимпанзе и т. д. Но все эндогенные ретровирусы человека на самом деле неактивны, они давно утратили свою активность в результате мутаций. Другое дело, что в ходе эволюционного процесса, получившего название «молекулярное одомашнивание», некоторые отдельные фрагменты ретровирусных геномов (но не целые геномы) иногда «кооптируются» хозяином для выполнения каких-то полезных функций (см. в заметках: Предки человека заимствовали полезные гены у вирусов; Наездники подавляют иммунную защиту своих жертв при помощи прирученных вирусов). Большинство встроенных ретровирусных геномов, однако, совершенно бесполезны для хозяина, да и «молекулярное одомашнивание» никоим образом не может объяснить факт их присутствия в одних и тех же местах в геномах разных видов.

Псевдогены

Псевдогены — это неработающие, «молчащие» гены, которые возникают в результате мутаций, выводящих нормальные «рабочие» гены из строя (существуют и другие, более редкие пути возникновения псевдогенов). Псевдогены представляют собой настоящие «генетические рудименты«. Если мутация выведет из строя ген, полезный для организма, она почти наверняка будет отсеяна отбором. Однако некоторые гены, в прошлом полезные, могут стать ненужными, например, из-за смены образа жизни. Мутация, выводящая из строя такой ген, не отсеивается отбором и может закрепиться в популяции. Псевдогены могут долго сохраняться в геноме в качестве ненужного «балласта». Мутации, которые в дальнейшем будут происходить в псевдогене, безразличны для выживания организма, и поэтому такие мутации свободно накапливаются и в конце концов могут изменить псевдоген до неузнаваемости. Однако на это уходит обычно много времени (десятки или даже сотни миллионов лет). Поэтому в геномах большинства организмов, включая человека, псевдогены на той или иной стадии мутационной деградации присутствуют в больших количествах. Псевдогены представляют собой своеобразную «историческую хронику», рассказывающую об образе жизни и адаптациях далеких предков изучаемого организма.

Например, в геноме человека в псевдогены превратились многие гены обонятельных рецепторов. Это и понятно, поскольку обоняние не имело существенного значения для выживания людей в историческое время, и, по-видимому, в доисторическое тоже (подробнее см. в заметке: Обоняние и цветное зрение в эволюции млекопитающих развивались в противофазе).

Ярким доказательством эволюции является присутствие одинаковых псевдогенов в одних и тех же местах генома у видов, произошедших сравнительно недавно от общего предка. Так, у человека есть псевдоген GULO, который представляет собой «сломанный» ген фермента глюконо-лактон-оксидазы. Этот фермент необходим для синтеза аскорбиновой кислоты. У других приматов обнаружен точно такой же псевдоген, причем мутационная «поломка», нарушившая работу гена, у него такая же, как и в человеческом псевдогене. Причины очевидны: в связи с переходом предков современных приматов к питанию растительной пищей, богатой витамином C, данный ген перестал быть необходимым для выживания. Мутация, испортившая ген, не была отсеяна отбором, закрепилась и была унаследована обезьянами и человеком. У других млекопитающих (например, у крысы) GULO является не псевдогеном, а работающим геном, и поэтому крысам не нужно получать витамин C с пищей: они синтезируют его сами. В других группах млекопитающих, которые независимо от приматов перешли к питанию пищей, богатой витамином С, тоже произошла псевдогенизация гена GULO, но мутации, выведшие ген из строя, у них были другие (пример — морские свинки).

Еще один пример: у млекопитающих есть три гена, которые у птиц и рептилий отвечают за производство белка вителлогенина, который входит в состав желтка в яйце. Почти у всех млекопитающих эти три гена — «мертвые», псевдогенизированные. Только яйцекладущие однопроходные звери (утконос, ехидна) синтезируют вителлогенин. У однопроходных из трех генов вителлогенина «мертвы» только два, а третий сохранил функциональность. Между прочим, хотя у плацентарных мелкопитающих желток не образуется, в ходе эмбриогенеза развивается рудиментарный желточный мешок (наполненный жидкостью), присоединенный к кишечнику зародыша. На втором месяце беременности у человека желточный мешок отделяется от эмбриона.

Подробнее о доказательствах эволюции, предоставляемых псевдогенами, см.: Sean D. Pitman. Pseudogenes.

См. также: Ф. Коллинз. «Расшифровка божественных чертежей» (Глава из книги Фрэнсиса Коллинза «Доказательство Бога. Аргументы ученого». 2008). Полный текст книги в формате djvu. Ф.Коллинз — крупный американский генетик, руководитель проекта «Геном человека». В книге «Доказательство Бога» он приводит генетические аргументы в пользу эволюции и обосновывает свою точку зрения о том, что современная эволюционная биология, как и наука в целом, не противоречат христианству.

7. Биогеографические доказательства

Географическое распространение животных и растений соответствует их эволюционной истории

Биогеография — наука, изучающая закономерности географического распространения животных и растений, а также характер фауны и флоры отдельных территорий.

Если два вида сравнительно недавно произошли от одной популяции, то они как правило обитают недалеко от ареала этой исходной популяции, а значит и недалеко друг от друга. Таким образом, географическое распределение видов должно быть совместимо с филогенетическим деревом. Если не принимать во внимание теорию эволюции, то разумно предположить, что виды живут в наиболее подходящих для них условиях. Теория эволюции же предсказывает, что должно быть много благоприятных для вида мест, в которых представители вида тем не менее отсутствуют в связи с наличием географических барьеров.

Именно так дело и обстоит на практике. Сумчатые встречаются почти исключительно в Австралии (раньше они водились и на других материках, но впоследствии вымерли, скорее всего, вытесненные плацентарными конкурентами). Плацентарные млекопитающие в Австралии представлены только китообразными, ластоногими и рукокрылыми (которые легко могли перебраться в Австралию через морские проливы), а также грызунами, которые появляются в палеонтологической летописи в миоцене, когда Австралия приблизилась к Новой Гвинее. При этом природные условия Австралии благоприятны и для других видов млекопитающих. Например, завезенные на континент кролики широко размножились и продолжают вытеснять аборигенные виды; завезенные несколько тысячелетей назад собаки одичали и размножились (динго). В Австралии и на юге Южной Америки и Африки встречаются двоякодышащие, нелетающие бескилевые птицы и свистуны (зубастые жабы), в других частях света они отсутствуют.

Условия обитания в пустынях Африки, Америки и Австралии очень похожи, и растения из одной пустыни хорошо растут в другой. Тем не менее, кактусы были обнаружены только в Америке (за исключением Rhipsalis baccifera, по всей видимости занесенного в Старый Свет перелетными птицами). Многие африканские и австралийские суккуленты (то есть растения, имеющие специальные ткани для запаса воды) внешне напоминают кактусы за счет конвергентной эволюции, но относятся к другим порядкам. Морские обитатели восточных и западных берегов Южной Америки различны, за исключением некоторых моллюсков, ракообразных и иглокожих, но на противоположных берегах Панамского перешейка живет около 30 % одних и тех же рыб, что объясняется недавним возникновением перешейка (около 3 миллионов лет назад) (см.: Present biogeography из архива TalkOrigins.org.)

Островная биогеография

На большинстве океанических островов (то есть островов, которые никогда не были соединены с материком) отсутствуют наземные млекопитающие, земноводные и другие животные, не способные преодолевать значительные водные преграды. Видовой состав фауны таких островов является результатом случайного занесения (и последующей адаптивной радиации) некоторых видов, чаще всего птиц, насекомых, летучих мышей (то есть форм, способных пересекать широкие водные пространства).

Например, на Гавайских островах живет множество эндемичных (нигде больше не встречающихся) птиц, растений и насекомых, но на них полностью отсутствуют местные пресноводные рыбы, амфибии, рептилии и наземные млекопитающие (не считая завезенных людьми). На острове св. Елены тоже отсутствуют все перечисленные группы животных, но есть местные птицы, насекомые и растения. На Галапагосских островах есть потомки случайно занесенных сюда рептилий (игуаны и черепахи; о том, как рептилии могут иногда пересекать морские проливы, см. ниже), но нет местных млекопитающих, амфибий и пресноводных рыб. Та же самая картина наблюдается на множестве других океанических островов.

Однако те формы, которые все же есть на океанических островах, часто присутствуют здесь в виде множества близкородственных видов (см. ниже о галапагосских вьюрках). На многих островах (Новая Зеландия, Маврикий, Каролинские, Марианские острова и др.) есть свои эндемичные виды летучих мышей. Почему предполагаемый разумный дизайнер создал эндемичные виды летучих мышей на островах, но не создал там никаких других млекопитающих? Наука объясняет это очень просто: наземные млекопитающие практически неспособны пересекать широкие проливы, а летучие мыши умеют летать.

Еще одним свидетельством в пользу эволюции является высокое сходство островных флор и фаун с флорами и фаунами ближайших крупных массивов суши. Например, животный и растительный мир Галапагосских островов, несмотря на все своеобразие, явно связан тесными родственными связями с флорой и фауной ближайшего материка — Южной Америки (откуда и были случайно занесены немногочисленные организмы, ставшие предками галапагосских эндемиков). При этом условия жизни на архипелаге имеют мало общего с условиями, характерными для южноамериканского побережья. Факты такого рода совершенно необъяснимы в рамках идеи о «независимых актах творения» (разве что Создатель нарочно хотел создать видимость эволюции на островах — но Бог не может быть обманщиком). Эволюционное учение делает все эти факты не только осмысленными, но и прогнозируемыми.

Заселение изолированных территорий

Как сухопутные нелетающие животные в принципе могут пересекать морские проливы? Чаще всего они их не пересекают совсем, и если, например, две близкородственные группы видов обнаруживаются по разные стороны широкого пролива, то это скорее всего означает, что их предки заселили обе территории еще до того, как данный пролив образовался. Исходя из этого допущения (с учетом палеонтологической летописи и/или «молекулярных часов») часто удается сделать правильные выводы о времени расхождения тех или иных массивов суши, которые затем подтверждаются геологическими данными. Но иногда сухопутные животные все-таки могут пересекать проливы. Как сообщает Р.Докинз в книге The Greatest Show on Earth (2009), «До 4 октября 1995 года на карибском острове Ангилла не было представителей вида Iguana iguana. В указанный день популяция этих крупных ящериц внезапно появилась на восточной стороне острова. К счастью, люди непосредственно наблюдали их прибытие. Ящерицы сидели на «плоту» из вырванных с корнем деревьев, некоторые из которых достигали 30 футов в длину. Деревья, очевидно, приплыли с соседнего острова, возможно с Гваделупы, расположенной в 160 милях. За прошедший месяц два урагана прошлись по этому району — Луис 4–5 сентября и Мэрилин спустя две недели; эти ураганы вполне могли вырвать деревья вместе с игуанами, для которых проводить время на деревьях — в порядке вещей. Новая популяция на Ангилле продолжала процветать в 1998 году, и доктор Ellen Censky, проводившая оригинальное исследование, сообщила мне, что игуаны процветают и сегодня, причем, похоже, даже в большей степени, чем другие виды игуан, которые обитали на Ангилле и раньше.»

Рыбы-цихлиды озера Малави (сверху) и Виктория (снизу). В Малави вода более прозрачная, в ней лучше распространяется коротковолновый свет, поэтому многие рыбы имеют синюю и фиолетовую окраску. В оз. Виктория вода мутная, поэтому наряды цихлид выдержаны в основном желто-красных тонах.


Попав на большой остров с бедной фауной (или, для водных животных — в большое озеро), такие виды-вселенцы с большой вероятностью испытают адаптивную радиацию — быстрое видообразование, в ходе которого они займут ряд свободных экологических ниш. Кроме галапагосских вьюрков, хорошие примеры таких быстрых адаптивных радиаций — это рачки-бокоплавы озера Байкал (зачем Создателю нужно было создавать специально для озера Байкал 250 нигде больше не встречающихся видов рачков-бокоплавов, пусть антиэволюционисты придумывают сами), рыбы-цихлиды больших Африканских озер (Малави, Виктория), дрозофилы Гавайских островов и др.

Когда полинезийцы открыли Гавайи около 1500 лет назад, они нашли здесь около 60 видов цветочниц (это определили по ископаемым остаткам), из которых до наших дней дожило лишь около 20. Все это разнообразие произошло от единственного вида птиц, случайно занесенного на Гавайи около 4 млн лет назад.

Во многих случаях обнаруживается хорошее соответствие между временем образования острова или озера (которое определяется по геологическим данным) и временем начала адаптивной радиации группы местных эндемиков, которое устанавливается путем сравнения геномов (см.: Молекулярные часы). Хорошим примером являются усачи озера Тана, о которых рассказано в другом разделе данной публикации.

Ослабленная конкуренция и незанятость многих ниш в островных экосистемах часто приводит к тому, что ниша занимается организмом, который в нормальных условиях (на континенте) никогда бы такую нишу не занял, потому что там она занята более квалифицированными «профессионалами» (напр., дятловый вьюрок и морская игуана на Галапагосах).

См. также: Дж. Симпсон. Великолепная изоляция.

Дарвиновы вьюрки

Галапагосские вьюрки, впервые описанные Дарвином.

Во время кругосветного путешествия на корабле «Бигль» Чарльз Дарвин описал 13 видов вьюрков, обитающих на Галапагосских островах. Именно наблюдение за этими птицами натолкнуло Дарвина на идею происхождения видов за счёт изменчивости и естественного отбора. Предположение о том, что Бог специально для Галапагосских островов совершил 13 самостоятельных актов творения, сотворив 13 столь близких, но все-таки разных видов вьюрков, явно противоречило здравому смыслу. Ясно, что изначально здесь жил только один вид вьюрков, который затем был «модифицирован» дюжиной разных способов (one species had been taken and modified for different ends). Ни на одном материке и ни на одном континентальном острове нет такого резкого преобладания вьюрков в орнитофауне.

Все галапагосские вьюрки происходят от общего предка, случайно попавшего сюда из Южной Америки. От предковой формы, питавшейся семенами, произошли три группы птиц: семеноядные земляные вьюрки, насекомоядные древесные вьюрки и славковые вьюрки, которые тоже питаются мелкими насекомыми. В результате приспособления к разным источникам пищи вьюрки стали сильно отличаться друг от друга строением клюва. Три обычных вида земляных вьюрков — большой, средний и малый — встречаются на большинстве островов. Там, где эти три вида проживают вместе, они хорошо различаются по размерам клюва и, соответственно, по величине предпочитаемых семян. На одном из островов обитает лишь средний земляной вьюрок, и здесь у птиц клювы меньше — в отсутствие конкурента средний земляной вьюрок занимает отчасти нишу малого вьюрка (см.: Географическое видообразование. Дарвиновы вьюрки).

Параллельная эволюция на разобщенных массивах суши

Крайне трудно с креационистских позиций объяснить, почему разные группы животных на разобщенных массивах суши дают сходные наборы жизненных форм. При этом аналогичные формы на разных материках сходны между собой по «поверхностным» признакам, которые связаны с приспособлением к конкретному образу жизни, тогда как сходство по «глубинным» признакам, отражающим генетическое родство, у них наблюдается не с заморскими аналогами, а с соседями по материку, пусть и непохожими внешне. Параллельная (конвергентная) эволюция на разных материках, приводящая к появлению сходных приспособлений, объясняется тем, что животные, ведущие сходный образ жизни, подвергаются сходному давлению отбора, и поэтому у них могут развиваться похожие адаптации.

Параллельная эволюция на разобщенных массивах суши. Справа — американские плацентарные млекопитающие, слева — их австралийские сумчатые аналоги (Coyne, 2009). Внешне (т. е. по «поверхностным» адаптивным признакам) сумчатая летяга больше похожа на обычную летягу, чем на сумчатого крота или сумчатого муравьеда. Однако по более «глубоким» (т. е. эволюционно древним) анатомическим и эмбриологическим признакам, а также по нуклеотидным последовательностям ДНК, она гораздо ближе к другим австралийским сумчатым. Поэтому ее и относят к отряду сумчатых, а белку-летягу — к отряду грызунов.


Еще один хорошо изученный пример параллельной эволюции на изолированных островах описан в заметке «Видообразование на разных островах идет параллельными путями.» Подробнее о параллельной эволюции см. в наших обзорах: «Направленность эволюции«и «Параллелизмы и гомологическая изменчивость«.

Распространение ископаемых видов согласуется с эволюционным деревом и палеогеографическими реконструкциями

Географическое распределение видов в прошлом, которое можно частично восстановить по ископаемым останкам, также должно соответствовать филогенетическому дереву. Теория тектоники плит и теория эволюции позволяют предсказать, где следует искать те или иные ископаемые остатки. Древнейшие окаменелости сумчатых найдены в Северной Америке, их возраст составляет около 80 миллионов лет. 40 миллионов лет назад сумчатые уже были распространены в Южной Америке, но в Австралии, где они сейчас доминируют, сумчатые появились только около 30 миллионов лет назад. Теория эволюции предсказывает, что австралийские сумчатые произошли от американских. Согласно теории тектоники плит, 30–40 миллионов лет назад Южная Америка и Австралия еще оставались частью Гондваны, крупного континента в южном полушарии, а между ними находилась будущая Антарктида. На основании двух теорий исследователи предсказали, что сумчатые мигрировали из Южной Америки в Австралию через Антарктиду 30–40 миллионов лет назад. Это предсказание подтвердилось: начиная с 1982 года на острове Сеймур, расположенном недалеко от Антарктиды, были найдены более десяти видов ископаемых сумчатых возрастом 35–40 миллионов лет.

Распространение многих ископаемых организмов крайне трудно объяснить, если не учитывать тектонику плит (дрейф континентов). Распространение этих организмов на современной карте мира кажется бессистемным и хаотическим, однако оно сразу делается осмысленным и понятным, если мы наложим его на разработанные геологами палеогеографические реконструкции.

Положение континетов сегодня (верхний рисунок) и в пермском периоде (299–251 млн лет назад). Серым цветом выделены области распространения ископаемого семенного папоротника Glossopteris. В пермском периоде это растение было распространено в зоне с прохладным климатом вокруг южного полюса. На эту область периодически наползали с юга ледники, оставившие характерные следы в геологической летописи, по которым можно определить направление их движения (стрелки). И распространение Glossopteris, и направление движения ледников выглядят совершенно естественно и осмысленно на палеогеографической реконструкции, но не на современной карте мира Из Coyne, 2009.


Для самого Дарвина важным аргументом в пользу изменяемости видов стал тот факт (отмеченный им самим в ходе кругосветного путешествия на корабле «Бигль»), что вымершие животные, чьи ископаемые остатки встречаются в данном регионе, часто похожи на современных жителей этого региона больше, чем на обитателей других регионов. Например, в Южной Америке, где живут современные ленивцы и броненосцы, встречаются ископаемые остатки их вымерших родственников — гигантских ленивцев мегатериев и гигантских броненосцев глиптодонтов. Ни современные ленивцы, ни броненосцы, ни их ископаемые родичи ни разу не были найдены в Старом Свете. Именно такую картину и следует ожидать, если виды не создавались Творцом в готовом виде, а происходили друг от друга в ходе эволюции.

Ближайшие родственники современных людей — гориллы и шимпанзе — обитают в Африке. Исходя из этого, в 1872 году Чарлз Дарвин предположил, что и древних предков человека следует искать в Африке. Многие исследователи, такие как Луис, Мэри и Ричард Лики, Рэймонд Дарт и Роберт Брум, последовали совету Дарвина, и начиная с 1920-х годов в Африке было найдено множество промежуточных форм между человеком и человекообразными обезьянами (см.: Происхождение и эволюция человека). Если бы ископаемых австралопитеков обнаружили, например, в Австралии, а не в Африке, то теорию эволюции пришлось бы пересматривать (см.: Дарвин 1859. Глава 12. Географическое распространение.; Глава 13. Географическое распространение (продолжение))

Часть III. Дополнительные материалы

8. Полезная литература и ссылки

Доказательства эволюции и опровержение «доводов» антиэволюционистов

• Великолепный и очень подробный сайт TalkOrigins, где есть (по-английски) практически все, что только можно пожелать: доказательства эволюции, опровержение всех антиэволюционистских бредней, разъяснение неясных моментов в эволюционной теории — и все это на очень серьезном уровне. Жаль, что у нас пока нет возможности перевести этот сайт полностью на русский язык.

• Richard Dawkins. The Greatest Show on Earth: The Evidence for Evolution. 2009. (pdf 24 Mb; html 9 Mb)

• Coyne J.A. Why evolution is true. 2009

• Доказательства эволюции. (на сайте Дарвиновского музея)

• П.М.Бородин. Эволюция — пути и механизмы.

Маст рид по эволюции

• Ч. Дарвин. «Происхождение видов«(к сожалению, это шестое издание, а самым лучшим было первое, но его пока нет в сети).

• Р. Докинз. Эгоистичный ген

• К.Ю.Еськов. История Земли и жизни на ней.

Учебники и т. п

• Ч. Дарвин. Происхождение человека и половой отбор. В формате html (рассчитано на Internet explorer). Шрифты с ятями скачать

• Н.Н.Иорданский. Эволюция жизни

• А. С. Северцов. Теория эволюции. 2005 (djvu, 9Mb)

• Н.В.Тимофеев-Ресовский, Н.Н.Воронцов, А.В.Яблоков. Краткий очерк теории эволюции. 1977 (djvu, 4Mb)

• А. В. Яблоков, А. Г. Юсуфов. Эволюционное учение. 2006 (djvu, 9Mb)

• Daniel Dennett. Darwin's dangerous idea (pdf)

• Книги Ричарда Докинза:

• The Blind Watchmaker. 1987

Слепой часовщик перевод Анатолия Протопопова)

• The Extended Phenotype 1982

Расширенный фенотип (перевод Анатолия Протопопова)

• Climbing Mount Improbable 1996

• River out of Eden 1996

• Unweaving the rainbow 1998

• A Devil's Chaplain 2004

• The Ancestor's Tale. 2004. (pdf, 6Mb)

The Ancestor's Tale. 2004. (html)

• В.Грант. Эволюционный процесс. М.: 1991. Загрузить zip-файл.

• Ну и наша библиотека вообще

9. Этические и эстетические аргументы против креационизма

Аргументация, приведенная в этом разделе, не является научной в строгом смысле слова. Двое из авторов настоящей публикации (Н.М.Борисов и А.Б.Шипунов) не согласны с этой аргументацией, считая, что здесь делается попытка «доказать отсутствие Бога». По мнению других, здесь нет попытки обосновать атеизм, а есть лишь попытка продемонстрировать нелогичность представлений о том, что существующие на земле виды живых существ были целенаправленно созданы сверхъестественной разумной силой.

Поскольку данный раздел был одобрен только частью авторского коллектива, мы просим рассматривать его в качестве дополнительного и помнить о том, что приведенная в нем аргументация, во-первых, не является строго научной, во-вторых, представляет собой личное мнение не всех, а только части авторов.

Введение

За редкими исключениями, антиэволюционисты являются религиозными людьми, считающими, что эволюция противоречит их вере. Именно это и заставляет их искать аргументы против эволюции (хотя есть немало верующих, признающих эволюцию; см. «Вступительное слово«). Антиэволюционисты-безбожники — довольно редкое явление. Трудно быть одновременно антиэволюционистом и безбожником, потому что в таком случае у вас не остается вообще никаких внятных объяснений наблюдаемого на Земле огромного разнообразия и поразительной приспособленности (адаптированности) живых существ. Если не Бог и не эволюция — кто же тогда создал все это? То, что разнообразие и приспособленность живых существ нельзя объяснить «простой случайностью» — это чуть ли не единственное утверждение, по которому между эволюционистами и антиэволюционистами нет никаких разногласий.

Вопреки распространенному среди антиэволюционистов заблуждению, теория эволюции вовсе не предполагает, что разнообразие и приспособленность живых организмов объясняются «простой случайностью». Более или менее случайными являются только мутации, однако естественный отбор — процесс закономерный, и он придает эволюционным изменениям направленность и видимость осмысленности («разумного дизайна»). Хорошая аналогия: кристаллы образуются из хаотически («случайно») движущихся молекул, но физико-химические законы кристаллизации придают образующимся из этого хаоса кристаллам строго определенную форму и структуру.

Единственной логичной альтернативой эволюции является предположение о том, что живые существа являются результатом целенаправленного творчества некой разумной силы (идея «разумного замысла», или «разумного дизайна»). Но в таком случае у нас в руках огромный и разнообразный материал, позволяющий судить о свойствах, возможностях, личных качествах, морали и вкусах этой разумной силы. Точно так же, как по остаткам материальной культуры исчезнувшей цивилизации (например, древних египтян или майя) мы можем очень многое узнать о людях, создавших эту цивилизацию, так и биология должна давать богатейший материал для изучения личности предполагаемого Творца (или творцов, если это был творческий коллектив, а не мастер-одиночка). Именно так рассуждали и продолжают рассуждать многие религиозные мыслители-антиэволюционисты (классический труд в этой области: Paley, W. 1809. Natural Theology: or, Evidences of the Existence and Attributes of the Deity). Они видят в «совершенстве и гармонии природы» результат благонамеренных и мудрых действий Творца. Однако при ближайшем рассмотрении органический мир вовсе не производит впечатления сплошного «совершенства и гармонии».

В этом разделе мы рассмотрим ряд аргументов против теории «разумного замысла», которые вытекают из принятых среди религиозных антиэволюционистов этических и эстетических оценок явлений природы. Данные аргументы не являются научными в строгом смысле — мы просто попробуем поиграть немного по правилам, предлагемым религиозными антиэволюционистами, которые верят, что виды живых существ созданы Творцом, небезразличным к вопросам морали. С научной точки зрения, наблюдаемые факты совершенно однозначно свидетельствуют о том, что природа полностью индифферентна к человеческим представлениям о добре и зле или прекрасном и безобразном. Поэтому для науки рассматриваемые здесь примеры не представляют никакого парадокса. По ходу дела мы убедимся, насколько ненаучной и бесперспективной является сама идея применения к живой природе человеческих понятий о морали и красоте.

Необычайная любовь к жукам

Некоторые весьма яркие и характерные особенности живой природы выглядят в высшей степени странными, если пытаться увидеть в них результат чьего-то сознательного творчества. Согласно известному историческому анекдоту, выдающегося биолога Джона Холдейна однажды спросили, какие черты личности Создателя наиболее ярко проявились в его Творении. «Необычайная любовь к жукам» — ответил Холдейн. Действительно, кому могло понадобиться творить столько жуков? На сегодняшний день их известно около 350 тысяч видов (для сравнения, млекопитающих — около 6 тысяч видов). Жуки — самая разнообразная группа насекомых, а насекомые — самая разнообразная группа живых существ, значительно превосходящая по видовому богатству все остальные группы вместе взятые. Заметим, что для биологии немыслимое разнообразие жуков вовсе не представляет неразрешимой загадки (см.: Невероятное разнообразие жуков получило эволюционное объяснение). Большинство видов жуков — это малочисленные, малоизвестные, не играющие существенной экологической роли, можно сказать, «Богом забытые» виды, рассеянные по тропическим лесам Африки, Азии и Америки. Здравый смысл нам подсказывает, что сотворить их мог только некто, одержимый неизъяснимой страстью к сотворению жуков. Другие группы насекомых ставят перед религиозными антиэволюционистами тот же вопрос. Например, зачем было творить на одних только Гавайских островах 500 эндемичных (нигде больше не встречающихся) видов плодовых мушек?

«Как Бог черепаху»

Некоторые «творения» явно свидетельствуют либо о дурном вкусе, либо о некомпетентности предполагаемого «дизайнера». Приписывая авторство подобных «творений» Богу, антиэволюционисты совершают что-то очень похожее на кощунство. Дизайн камбалообразных рыб, особенно анатомия их перекошенной, изуродованной, асимметричной головы, поражает своим безобразием и нерациональностью. Почему было не спроектировать камбал по образцу скатов, которые достигают той же цели (могут распластаться по дну и затаиться), сохраняя при этом симметрию и гармоничное соотношение частей тела? Для теории эволюции камбалы тоже долго представляли довольно сложную проблему, которая, однако, была успешно разрешена благодаря недавним палеонтологическим находкам (см.: Ископаемые рыбы в очередной раз подтвердили правоту Дарвина).

Скорпена


Можно привести очень много примеров причудливого и, по человеческим меркам, нелепого и уродливого «дизайна» в живой природе. Мальки некоторых рыб плавают, загребая глазами на длинных стебельках. Морской конек-тряпичник и скорпена выглядят по-идиотски в своих бесформенных кожных лохмотьях, служащих для маскировки. Глубоководные удильщики, подманивающие глупых рыбешек приманкой,

похожей на червячка или просто кусочек какой-то аппетитной гадости, — еще одно яркое проявление дурного вкуса предполагаемого «дизайнера». Инстинкты многих животных тоже «спроектированы» не лучшим образом: как объяснить с антиэволюционных позиций, например, удивительную слепоту птиц-родителей, продолжающих честно кормить кукушонка даже тогда, когда он уже в несколько раз превосходит их по размеру и давно уже выкинул из гнезда их собственных птенцов? Причем, что самое удивительное, эти же птицы прекрасно умеют отличать чужие яйца от своих собственных, и поэтому кукушки, как правило, откладывают яйца, очень похожие по размеру окраске на хозяйские — иначе обман сразу будет замечен. Слепота родителей распространяется только на птенцов (кукушата совсем непохожи на птенцов жертв гнездового паразитизма). Что это за «разумный дизайн» — снабдить птиц способностью разбираться в яйцах, но полностью лишить их умения разбираться в птенцах? С точки зрения эволюционной теории, опять-таки, все это легко объяснимо (см.: Обнаружить птенца-подкидыша — слишком сложная задача для птичьих мозгов?).

Рыба-капля (род Psychrolutes)


А что можно сказать о вкусе «дизайнера», сотворившего цветы, опыляемые навозными мухами и потому источающими аромат тухлого мяса?

Другие примеры несовершенства и явных нелепостей в «дизайне» живых существ, прекрасно объясняемые эволюционной теорией, но затруднительные для религиозных антиэволюционистов, рассмотрены выше в разделе «Несовершенство строения организмов«.

Глубоководный удильщик

Утонченный садизм

Дарвин признался в одном из писем, что не представляет, как мог благой и милосердный Создатель сознательно сотворить наездников-ихневмонид, чтобы они развивались в теле своих жертв, пожирая их заживо изнутри. Наездники — большая и разнообразная группа перепончатокрылых насекомых, ведущая исключительно садистский образ жизни. Они откладывают яйца в тело своей жертвы (гусеницы, паука, тли и т. п.), причем во многих случаях жертва предварительно парализуется уколами жала в нервные узлы. Вышедшие из яиц личинки пожирают живую плоть жертвы, начиная с наименее важных органов — чтобы пища как можно дольше оставалась живой и свежей. Сначала съедаются жировые отложения, мускулатура, пищеварительная и половая системы, а те органы, без которых жертва сразу погибнет (например, нервная система), приберегаются напоследок. Могло ли разумное и благожелательное существо сознательно сотворить этот кошмар?

Личинки наездника съели заживо изнутри свою жертву — гусеницу, вылезли наружу и окуклились

Некоторые религиозные антиэволюционисты пытаются объяснить подобные примеры чудовищной жестокости природы, а заодно и вообще все случаи хищничества и паразитизма, вмешательством дьявола (как вариант: нечистых духов, активизированных грехопадением людей, «ибо земля проклята ради греха Адама»). Предполагается, что именно дьявол или нечистые духи внесли элемент зла в изначально «безгрешное» и чистое творение Создателя. При этом иногда указывают, например, что «даже лев в принципе может питаться растительной пищей; по изначальному замыслу Бога в природе не было ни смерти, ни хищников, ни паразитов, ни болезней». Из этой «гипотезы» вытекает множество проверяемых следствий. Надо ли говорить, что они совершенно не выдерживают эмпирической проверки? Попробуйте «разложить», например, того же льва на два «слоя» разумного дизайна: изначальный благой и более поздний — злонамеренный. Ничего не получится. Лев весь, от носа до кончика хвоста, спроектирован как устрашающая и совершенная машина для убийства и пожирания мяса, а вовсе не травы. При этом он весьма красив и гармоничен с точки зрения человеческой эстетики. Если льва и можно в принципе сохранять какое-то время живым на вегетарианской диете, то очень многие группы животных в принципе не способны питаться ничем, кроме живой добычи (например, почти все паукообразные кроме мелких растительноядных клещей, хищные жуки, большинство акул и мн. др.) Природа абсолютно безразлична к нашим представлениям о морали и эстетике, и поэтому мы повсеместно видим в ней причудливую смесь «добра» и «зла», «красоты» и «безобразия». Одно из проверяемых следствий вышеописанных богословских рассуждений состоит в том, что «благой» дизайн во времени предшествовал «злому», и поэтому в природе признаки «зла» должны быть наложены поверх «добрых» признаков. С этой позиции очень трудно объяснить, например, как появились у «добрых» травоядных животных приспособления, защищающие их от «злых» хищников. Или Бог заранее предусмотрел, что Сатана вмешается и создаст хищников, и заботливо снабдил свои «добрые» творения защитой от «злых» творений Сатаны, которым только предстояло появиться в будущем, когда Адам и Ева активизируют нечистых духов путем съедания запретного плода? Священные книги ведь ничего не говорят о том, что Творец сотворил часть «благих» созданий уже после того, как люди совершили грехопадение и нечистые духи частично изуродовали изначальную «благость» природы.

Например, орхидеи — прекрасные творения, радующие человеческий глаз и обоняние, явно не дело рук диавола. Но среди них есть виды, цветы которых замаскированы под тех несчастных пауков, на которых охотятся наездники, чтобы парализовать их и отложить в них яйца. Наездники принимают цветы за пауков, нападают на них — и переносят пыльцу с одного цветка на другой. Орхидеи, таким образом, используют садистские наклонности наездников к собственной выгоде. Если хищники явно «спроектированы» для убийства, то многие их жертвы — «благие» травоядные животные, такие как газели — точно так же, от носа до хвоста, «спроектированы» как машины для удирания от хищников.

Эта орхидея опыляется наездниками, которые принимают ее цветок за паука — свою обычную жертву.

Огромное число видов животных используют сложные и эффективные способы маскировки — либо чтобы не быть замеченными хищниками, либо, наоборот, чтобы незаметно подкрадываться к жертвам. Иммунная система — важнейшая интегральная часть многоклеточного организма, особенно сильное развитие получившая у позвоночных. Ее, что ли, тоже Бог создал заранее, предвидя создание нечистыми силами вирусов, бактерий и способности собственных клеток организма к злокачественному перерождению?

Сколько бы мы ни присматривались к адпатациям для хищничества и паразитизма — «творениям нечистых духов», и к адаптациям для защиты от них или для «мирной» травоядной жизни — делу рук «благого Творца» — мы не заметим принципиальных различий ни в совершенстве этих адаптаций, ни в их сложности и причудливости, ни в общем «стиле» дизайна. А ведь, казалось бы, творения нечистых духов должны резко отличаться по стилю, да и по совершенству, от творений благого и всемогущего Бога.

В действительности, как нетрудно догадаться, ни одному вменяемому биологу даже в голову не придет всерьез раскладывать живую природу на «добрые» и «злые» компоненты — слишком уж очевидна абсурдность и бесперспективность такого наивно-антропоцентрического подхода.

Эволюционная теория предсказывает, что между хищниками, паразитами и их жертвами должна происходить эволюционная «гонка вооружений», явные признаки которой мы повсеместно наблюдаем в природе. Например, гонка вооружений между наездниками и их жертвами привела к тому, что они стали бороться друг с другом при помощи фактически одного и того же вирусологического оружия (см. в заметках: Наездники подавляют иммунную защиту своих жертв при помощи прирученных вирусов; Уникальный случай тройного симбиоза: вирус помогает бактерии защищать тлю от врагов). Попытки возбудителя гонореи обойти иммунную защиту человеческого организма привели к тому, что гонококк в ходе эволюции выработал приемы борьбы, очень похожие на те, что применяются самой иммунной системой (см.: Гонококки обманывают иммунную систему, внося контролируемые изменения в свой геном).

Другие примеры эволюционной гонки вооружений см. в заметках:

• Неядовитые змеи вырабатывают устойчивость к смертоносному яду тритонов

• Современные паразиты опаснее прошлых и будущих

• Муравьи стараются не пахнуть как гусеницы, пахнущие как муравьи

В природе в целом преобладают конкурентные, антагонистические взаимоотношения между организмами, что отлично объясняется современной эволюционной теорией, в частности, идеей «эгоистичного гена» (см.: Р. Докинз. «Эгоистичный ген«). При этом та же самая теория убедительно и достаточно просто объясняет многочисленные случаи альтруизма и кооперации в живой природе, равно как и то, почему эти случаи так и не стали повсеместным общим правилом (см.: А.В.Марков. Эволюция кооперации и альтруизма: от бактерий до человека). Пройдя по этим ссылкам, читатель может сам убедиться, насколько эти научные объяснения логичнее, обоснованнее и красивее, чем нелепые фантазии теологов-антиэволюционистов о «коллективном творчестве» добрых и злых сверхъестественных существ.

Другие яркие примеры удивительной безнравственности наблюдаемого в природе «дизайна» — это такие широко распространенные среди животных явления, как инфантицид и сиблицид. Инфантицид — убийство детенышей — часто осуществляется самцами, получившими доступ к самкам, у которых уже есть дети от других самцов. Например, львы-самцы, получившие доступ к группе львиц после гибели их прежних «мужей», стараются убить всех детенышей своих новых подруг — и обычно им это удается. Такое поведение совершенно не выгодно львам как виду, оно явно вредно для популяции, однако самцы-детоубийцы увеличивают тем самым свой репродуктивный успех (лишившись детенышей, львицы быстрее оказываются снова готовы к зачатию), и поэтому естественный отбор закрепил этот отвратительный поведенческий признак. Естественному отбору нет дела ни до нравственности, ни до «блага вида», им руководит только относительный репродуктивный успех особей. Он — безличная природная сила, поэтому с него нет спроса. Сиблицид — убийство родных братьев и сестер — особенно широко распространен у птиц, но встречается и у млекопитающих (у рысей, свиней и гиен). Есть птицы с облигатным (обязательным) и факультативным сиблицидом. В первом случае (например, у африканского черного орла Aquila verreauxii) из двух яиц, отложенных самкой, второе с самого начала является, по сути дела, «запасным». Родители тратят очень много сил на выращивание потомства (одно высиживание длится 45 дней), и выкормить двух птенцов им было бы слишком трудно. Яйца откладываются с интервалом в несколько суток, что обеспечивает неодновременность вылупления. Если старший птенец остается жив к моменту вылупления младшего, он нападает на только что вылупившегося брата или сестру и забивает его (ее) до смерти. Это происходит независимо от того, хватает ли в данный момент птенцам корма. Напротив, при факультативном сиблициде дело доходит до убийства только при нехватке пищи (см.: Братоубийственные драки детенышей не зависят от половых гормонов).

В заключение раздела приведем цитату из книги Конрада Лоренца «Кольцо царя Соломона«:

«Однажды я запустил в аквариум к своим землеройкам большую прудовую лягушку. С тех пор я никогда больше не делал этого — трудно было перенести последовавшую страшную сцену и конец несчастного земноводного. Одна из кутор увидела лягушку, плавающую в аквариуме, и сразу же кинулась на неё, норовя схватить животное за ногу. Хищник был отброшен в сторону, однако не прекратил нападения, и тогда доведённое до отчаяния земноводное выскочило из воды на один из столов. Здесь несколько других землероек пришли на помощь первому преследователю и вонзили свои зубы в лапы и в заднюю половину злополучной лягушки. И началось самое ужасное — куторы одновременно стали поедать добычу живьём, причём каждая начала с того места, где ей удалось ухватить несчастную жертву. Душераздирающее кваканье лягушки смешивалось с хором чавкающих челюстей её истязателей. Не следует строго осуждать меня за то, что я сам положил конец эксперименту, конец неожиданный и драматический, избавив истерзанное животное от дальнейших страданий. С тех пор я никогда не выпускал к своим куторам крупных животных, а лишь таких, которых маленькие хищники могли убить одним или двумя укусами.

Да, природа может быть очень жестокой. Не из жалости большинство крупных хищников убивает свою жертву быстро. Лев мгновенно приканчивает антилопу или буйвола лишь для того, чтобы самому не оказаться раненым. Животному, которое изо дня в день существует охотой, непозволительно получить даже безвредную царапину. Такие царапинки, накапливаясь, в определённый момент стали бы сказываться на успешности самой охоты. Те же самые причины заставляют питона и прочих крупных змей наиболее гуманным образом — в несколько мгновений — убивать хорошо вооружённых млекопитающих, служащих им постоянно пропитанием. Но там, где нет опасности, что жертва нанесёт повреждение убийце, не может быть и речи о какой-нибудь жалости. Ёж, полностью защищённый своей колючей броней от змеиных укусов, постоянно поедает пресмыкающихся начиная с хвоста или с середины туловища, и точно так же куторы обходятся со своей безобидной добычей.»

Конфликт полов

Ярким примером, демонстрирующим неадекватность антиэволюционистских «объяснений», является известный и хорошо изученный эволюционный феномен конфликта полов (sexual conflict). Это явление логически вытекает из неравного вклада самцов и самок в потомство. Самка всегда вкладывает в потомство больше собственных ресурсов, чем самец. Самец может произвести триллионы сперматозоидов и оплодотворить очень много самок, но самка может произвести лишь очень ограниченное количество яйцеклеток. Поэтому мужской «репродуктивный потенциал» всегда в избытке, а женский — в дефиците. Из этого проистекает конфликт эволюционных интересов между самцами и самками. Например, довольно часто возникает ситуация, когда отбор благоприятствует тем самцам, которым удается любой ценой спариться с как можно большим количеством самок, и тем самкам, которые ведут себя наиболее разборчиво и привередливо при выборе полового партнера.

К особенно смешным результатам приводит конфликт полов у гермафродитных организмов, которые при спаривании могут выступать как в роли самца, так и в роли самки, но при этом каждому выгоднее в каждом конкретном спаривании сыграть роль самца, а вовсе не самки. У некоторых беспозвоночных спаривание поэтому превратилось в отчаянную схватку, в ходе которой каждый из партнеров пытается не только оплодотворить другого, но и откусить ему пенис, чтобы не быть оплодотворенным самому. А некоторые плоские черви и вовсе разыгрывают комический спектакль под названием «фехтование на пенисах» (penis fencing). Какой «разумный дизайнер» все это проектировал? У него, очевидно, было крайне специфическое чувство юмора.

О некоторых следствиях конфликта полов у человека см. в заметке: Причиной психических заболеваний может быть конфликт между отцовскими и материнскими генами.

У некоторых уток, ведущих в принципе моногамный образ жизни (постоянные брачные пары), самцы при любом удобном случае пытаются изнасиловать соседских жен, а те сопротивляются. У большинства птиц самцы вообще не имеют пениса, но у селезней-насильников в ходе эволюции развился крупный пенис, спирально закрученный на манер штопора. У самок, их жертв, чтобы сохранить выгодную для самок возможность осуществлять осмысленный выбор полового партнера, развились адаптации для сопротивления насилию. А именно, их влагалище стало тоже закручиваться штопором, но в другую сторону. Так самкам легче избежать оплодотворения в случае насилия. Эта анекдотическая ситуация, прекрасно объясняемая эволюционной теорией, совсем не похожа на результат сознательного творчества разумных сверхъестественных агентов. Ну не предполагать же, в самом деле, что пенис селезней-насильников создан нечистой силой, а винтообразная вагина самок, помогающая им блюсти целомудрие — благонамеренным Творцом! Зато это типичный и очень характерный результат эволюционной «гонки вооружений» (Brennan et al., 2007. Coevolution of Male and Female Genital Morphology in Waterfowl).

Вагина (слева) и пенис (справа) уток Anas platyrhynchos, у которых распространена насильственная копуляция

Еще один яркий пример того, к чему приводит эволюционный конфликт полов, описан в статье П.Н.Петрова с показательным названием «Самцы жуков-плавунцов — насильники и убийцы«. Всем известны также примеры «сексуального каннибализма» (богомолы, пауки), когда самка съедает самца во время или после спаривания, а самец в некоторых случаях не только не сопротивляется, но даже сам бросается в челюсти своей кровожадной партнерши (это происходит у тех видов пауков, у которых самец имеет только один-единственный шанс спариться с самкой, поэтому спасать свою жизнь ему незачем, а «кормя» самку собой, он тем самым продлевает спаривание и в итоге оставляет больше потомства). Огромная коллекция блестяще описанных примеров такого рода содержится в научно-популярной книге Olivia Judson. Dr. Tatiana's sex advice to all creation. Нет лучшего способа убедиться в абсурдности предположения о «коллективном творчестве добрых и злых сверхъестественных сил», чем внимательно просмотреть один за другим все примеры в этой книге, по-честному пытаясь определить, что из этого создано «добрыми», а что «злыми» силами.

Таким образом, живая природа совсем не похожа на результат сознательного творчества каких-либо разумных агентов, неравнодушных к морали и красоте. Силы, создавшие ее, явно не разделяли человеческих представлений об этике и эстетике. Они были к ним полностью индифферентны. Именно так и должен был действовать естественный отбор, работающий в интересах «эгоистичного гена», но от разумного и благонамеренного Творца мы ожидали бы совсем другого.

10. Ответы на некоторые типичные «доводы» антиэволюционистов

Чрезвычайно подробный перечень утверждений антиэволюционистов и весьма обстоятельные научные ответы на них опубликованы на сайте TalkOrigins (по-английски). Многие «аргументы» противников эволюции рассмотрены в предыдущих разделах (они выделены вот таким шрифтом). В данном разделе мы поместили ряд дополнительных материалов, показывающих несостоятельность антиэволюционистской аргументации.

Почему «кембрийский взрыв» не является аргументом против эволюции

Многие крупные таксоны (типы и классы) современных животных впервые появляются в палеонтологической летописи в течение сравнительно короткого интервала времени в начале кембрийского периода (примерно 542–530 млн лет назад), то есть в геологическом масштабе времени — почти мгновенно. Антиэволюционисты иногда пытаются использовать этот факт в качестве аргумента против эволюции: дескать, он противоречит дарвиновским представлениям о постепенности эволюционного процесса, и непонятно, где же предки всех этих животных. Самому Дарвину «кембрийский взрыв» представлялся загадкой, которую его теория не могла объяснить. Усилиями последующих поколений биологов и палеонтологов эта загадка была в общих чертах разгадана. Популярный и подробный рассказ о новейших находках, современных фактах и теориях, объясняющих «кембрийский взрыв», читатель найдет в работах авторов настоящего материала:

А.Ю.Журавлев. Тени зарытых предков

К.Ю.Еськов. История Земли и жизни на ней. Глава 7.

В дополнение к этим статьям отметим, что «кембрийский взрыв» является ярким примером быстрой адаптивной радиации, что часто происходит с живыми организмами вскоре после их проникновения в обширную незанятую область экологического (нишевого) пространства. Аналогичные примеры мы наблюдаем и сегодня. Например, в молодом эфиопском озере Тана примерно за 10 тысяч лет из одной случайно попавшей туда формы (усач Barbus intermedius) развилось 14 разных форм, занявших разнообразные пустующие ниши (Sibbing et al., 1998). В том числе появились даже усачи-хищники, что крайне нехарактерно для карповых рыб вообще.

Усачи озера Тана


По своему строению многие из этих новых форм вполне заслуживают не только видового, но и родового статуса, однако по генетике они все очень близки, как им и положено, учитывая их молодой возраст. Поэтому сегодня одни ихтиологи считают эти формы разными видами, другие — только разновидностями. Как показывает изучение аналогичных процессов в более древних озерах Малави и Виктория, где в ходе адаптивной радиации сформировалось примерно по 500 видов рыб-цихлид, для развития полной генетической несовместимости между разошедшимися видами требуется порядка 4 — 14 миллионов лет. Поэтому неудивительно, что в лабораторных условиях усачи из озера Тана свободно скрещиваются и дают плодовитое потомство. Дайте им 15 миллионов лет — и они наверняка утратят эту способность, если условия жизни в озере останутся более-менее постоянными. Антиэволюционисты могут на это возразить, как это у них принято, что в африканских озерах «рыбы остались рыбами», появились только новые виды и роды, а во время кембрийского взрыва появились «целые новые типы». Но ведь новые типы тоже зарождаются сначала «всего лишь» как новые виды. Это только потом, в ретроспективе, появляется возможность оценить масштаб изменений и приписать группам, произошедшим от появившихся в ходе быстрой адаптивной радиации видов, более высокий таксономический ранг.

Еще следует добавить, что первые бесспорные следы присутствия настоящих многоклеточных животных (царство Metazoa), а именно губок, недавно обнаружены в отложениях криогенового периода Протерозойской эры — более чем за 93 миллиона лет до начала кембрийского периода (см.: Животные появились свыше 635 миллионов лет назад). Нет никаких сомнений, что непредвзятый биолог-систематик, попавший в криогеновый период и ничего не знающий о последующей эволюции земной жизни (ну, например, марсианин, по какой-то случайности имеющий наши современные понятия о принципах биологической систематики), никогда в жизни не выделил бы криогеновых губок в отдельное царство. Он классифицировал бы их как своеобразную специализированную группу колониальных жгутиконосцев — хоанофлагеллят (об этих жгутиконосцах см. в заметке: Расшифрован геном хоанофлагеллят — ближайших одноклеточных родичей всех многоклеточных животных).

Заметим также, что многие другие эволюционные события разворачивались куда более постепенно по сравнению с «кебрийским взрывом» (например, последовательно и через большие интервалы геологического времени появлялись отделы и классы высших растений, классы наземных позвоночных). Быстрые адаптивные радиации характерны для периодов, наступающих сразу после крупных экологических кризисов. Например, быстрая радиация млекопитающих и костистых рыб в начале Кайнозойской эры, 50–65 миллионов лет назад, была связана с вымиранием, соответственно, динозавров и аммонитов, что привело к освобождению множества экологических ниш.

Эволюция, случайность, энтропия, или Как Дарвин и Клаузиус оказались правыми одновременно)

— Эволюция не противоречит второму началу термодинамики

— Новая информация может создаваться не только разумом, но и сочетанием случайного изменения состояния системы с последующим необходимым (избирательным) запоминанием результатов этого изменения

Бог не играет в кости.

Альберт Эйнштейн

А ангелы смеются,

Разыгрывая в кости мой удел…

Лариса Бочарова

Мы все учились понемногу чему-нибудь и как-нибудь… Факт, печальный для учителей и ученых, но неопровержимый: среди многих научных концепций, которыми система образования пытается «загрузить» молодого человека, по истечении многих лет после завершения образования люди в большинстве своем помнят лишь несколько самых «хлестко» поданных идей. В списке таких концепций есть две, о которых одинаково хорошо помнят и которые одинаково плохо понимают — это второе начало термодинамики и теория биологической эволюции. Велик соблазн тут попенять на «косную и неэффективную» систему школьного образования. Однако следует учесть, что хотя эти обе концепции сформулированы уже давно (в середине XIX века), ответ на вопрос, как и почему они не противоречат друг другу, был дан лишь в последние полвека.

Не секрет, что пытливых школьников и студентов при изучении как теории эволюции, так и термодинамики гложет один «проклятый» вопрос. От изучения биологической эволюции у многих, если не у большинства, школьников и студентов, остается впечатление (не вполне верное, ибо и упрощение строения может приводить к эволюционному успеху, как в случае с паразитическими организмами), что эволюция «естественно направлена» от простого к сложному. От изучения второго начала термодинамики — что все системы, предоставленные сами себе, неизбежно «естественно портятся», накапливая в себе «беспорядок» (энтропию). Так как же Дарвин, первооткрыватель феномена естественного отбора в биологической эволюции, и Клаузиус с Томсоном, обосновавшие второе начало термодинамики, могут быть правы одновременно? Более того, если в эволюции так существенны случайные процессы, как же случайность и стихийность может производить на свет не хаос, а порядок и целесообразность?

Таких вопросов ни учителю, ни ученому не следует стесняться. Более того, они являются поводом, чтобы лучше разобраться самому в таком многоплановом явлении, как биологическая эволюция, которая требует для своего изучения хорошего понимания таких разных наук, как математика, физика, химия, биология одновременно. К сожалению, одному человеку очень трудно сочетать глубокие знания всех этих предметов сразу. Тем более трудна такая задача для педагога массовой школы. Поэтому при объяснении комплексных биологических явлений учителя-предметники в области, лежащей за пределами области их компетентности, порой пользуются не научными, а обывательскими понятиями «хаоса», «порядка» и «случайности», которые не проясняют, а лишь затуманивают суть вещей.

Обывателю «хаос» (отсутствие корреляций между вещами и явлениями) и энтропия, являющаяся «мерой количественного измерения хаоса» (математически это логарифм числа элементарных состояний, в котором может находиться система) зачастую кажутся мистическими, почти неподвластными рациональному познанию, едва ли не с инфернальным душком. Как писал К. Ю. Еськов,

энтропия (вполне заурядная физическая величина) незаметно приобретает отчетливые черты некого Мирового Зла, а нормальное функционирование живых систем вдруг разрастается до масштабов глобального противостояния сил Света и Тьмы.

Такими же мистическими и пугающими представляются обыденному сознанию и случайные явления в природе. Небезызвестный Т. Д. Лысенко, который так и не мог понять дарвинизма, подменяя его ламаркизмом, неслучайно говорил: «наука-враг случайности», и эта позиция отражает непонимание механистической наукой XVIII-начала XIX веков (в методологии которой фактически «застряла» лысенковщина) стохастического (вероятностного) характера многих процессов в природе. Не понимают сущности случайных процессов и религиозные антиэволюционисты (креационисты), говорящие, что биологическая эволюция якобы предполагает образование сложных систем в результате исключительно случайных процессов, и что единственной альтернативой случайному процессу является «разумный замысел».

Тем не менее, в современной науке в понятие случайности не заложено ничего мистического. Это всего лишь свойство события, не предопределенного однозначно начальным состоянием системы, в которой это событие происходит. Противоположностью случайности является не «разумный замысел», а необходимость, или детерминированность, то есть обусловленность исхода какого-либо события за счет причинно-следственных связей с предшествующими событиями.

Своей «непредсказуемостью» случайность пугала естествоиспытателей прошлого, воспитанных на жестко детерминированной картине мира, которую рисует классическая механика Ньютона. П. С. Лапласу такая «светлая и ясная» детерминированность казалась чем-то вроде проявления божественного провидения, повелевающего вещам вести себя «как положено», вплоть до мечты о всеведении: с именем этого ученого связано понятие о «демоне Лапласа», решающем уравнения Ньютона, и поэтому знающего о судьбе мира все. Симптоматично, что именно Лаплас впервые попробовал количественно применить законы Ньютона не только «вперед», но и «назад» во времени, переложив гипотезу И. Канта о возникновении солнечной системы на язык математики. В рамках такого подхода временнáя эволюция мира мыслилась едва ли не фаталистически предопределенной, а «случайность», подобно «хаосу», казалась чуть ли не «игрой темных сил».»Страх случайности» оказался унаследованным официозной философией советской эпохи, которая (в этом она мало отличалась от креационизма) стремилась политизировать естествознание, приспособив его к своему мировоззрению. Как писала Большая советская энциклопедия,

Случайность — отражение в основном внешних, несущественных, неустойчивых, единичных связей действительности; выражение начального пункта познания объекта; результат перекрещивания независимых причинных процессов, событий; форма проявления необходимости и дополнение к ней.

В таком понимании (идущем от классической механики), случайность является следствием не более чем несовершенства нашего разума. Классическим примером здесь может служить бросание игральной кости. В этом случае, хотя нам со времен Ньютона хорошо известны законы природы, влияющие на движение кости, исход бросания мы предсказать не можем, так как из-за погрешности в знании начальных условий решение задачи о поведении кости в полете является неустойчивым по отношению к начальным условиям. Иными словами, малые изменения начальных условий влекут за собой существенное изменение исхода события (выпадение другого числа на кости).

В еще более «затруднительном» положении оказалась классическая термодинамика XIX века, когда перед нею встала проблема решения уравнений движения атомов и молекул, составляющих рабочие тела тепловых машин. Даже если вообразить себе атомы абсолютно твердыми и упругими шарами, предсказать движение каждого такого «шара» становится совершенно невозможно. Правда, в классической термодинамике стохастическую картину на микроуровне удалось «обуздать» с помощью термодинамических потенциалов — функций, представляющих собой усредненные по статистическому ансамблю значения энергий частиц. Подход оказался плодотворным: раз уж мы не можем предсказать поведение каждой частицы в ансамбле, в котором не один миллиард миллиардов частиц, то следует заняться предсказанием, как ведут себя некоторые усредненные показатели системы. Создателям классической термодинамики — от Карно с Клаузиусом до Гельмгольца с Гиббсом — повезло: в терминах термодинамических потенциалов поведение квазиравновесных систем оказалось детерминированным, что до поры до времени сохраняло идущую от Лапласа уверенность в предсказуемости мира.

Тем не менее, термодинамика внесла в картину мира одну принципиальную деталь: в отличие от классической механики, которой все процессы были обратимы во времени, второе начало термодинамики утверждает направление «стрелы времени» — от прошлого к будущему. Несмотря на почти мистическое и фаталистическое отношение неспециалистов ко второму началу термодинамики (мол, оно предопределяет тенденцию к «порче» мира и превращению его в хаос) это начало есть простое следствие из принятого в статистической физике постулата о равновероятности элементарных состояний сложной системы. Поскольку в неупорядоченной системе число элементарных состояний больше, чем в упорядоченной (наглядный пример: выстроить 10 томов собрания сочинений Пушкина по порядку можно лишь единственным образом, а в беспорядке их можно тасовать 10! = 1 * 2 * 3 * … * 10 = 3 628 800 раз), то при равновероятности изменения элементарных состояний в замкнутой системе, не обменивающейся энергией с внешней средой, вероятность увеличения упорядоченности ничтожно мала.

Тем не менее, опыт показывает, что не каждая в мире система стремится к «хаосу» и «порче». Та же классическая термодинамика зародилась как наука о тепловых машинах, которые преобразуют хаотичное движение микрочастиц в упорядоченное движение поршней, валов и колес. Действуя подобным образом, тепловые машины, разумеется, не нарушают второе начало: они преобразуют в полезную работу не всю хаотичную внутреннюю энергию рабочего тела, а только часть ее. Кроме того, такие машины способны работать только потому, что они потребляют энергию химических связей топлива (сгоревшее состояние для топлива энергетически выгоднее несгоревшего).

Так работает и двигатель вашего автомобиля, и холодильник в вашем доме, и огнестрельное оружие. Подобно тепловым машинам, биологические системы являются ни чем иным, как устройствами, потребляющими энергию Солнца и земных недр и преобразующими ее в упорядоченную эволюцию живого вещества. Так работает и рибосома, и митохондрия, и клетка, и каждый живой организм, и биогеосфера Земли в целом, являясь машиной эволюции видов. Более того, по принципу тепловых двигателей работают не только изделия человеческих рук и живые существа. Такие объекты неживой природы, как конвективные ячейки (см.: ячейки Бенара), морские течения, сезонные ветры, циклоны и т. д. тоже преобразуют хаос в порядок.

Однако нарушения второго начала термодинамики в этом нет. Дело в том, что упорядочение строения материи в ходе работы тепловых двигателей происходит только в ограниченной области пространства и только на ограниченное время. Во внешней по отношению к рабочему телу среде энтропия увеличивается, так что суммарная энтропия системы «рабочее тело плюс внешняя среда» все равно возрастает, в соответствии со вторым началом. Кроме того, тепловые двигатели могут работать, только потребляя энергию от внешних источников, то есть они не вечны.

Дж. Максвелл, рассуждая над вторым началом термодинамики, ввел понятие демона Максвелла — устройства, которое могло бы сортировать молекулы газа по скоростям и тем самым понижать энтропию в сосуде. В настоящий момент ясно, что «демон Максвелла» возможен (более того, все тепловые двигатели являются по сути такими «демонами»), однако он в процессе работы должен потреблять энергию из внешнего источника и диссипировать (рассеивать) ее в среду, тоже внешнюю по отношению к газу в сосуде.

Часто даже в школьных учебниках и научно-популярных книгах на вопрос, для каких систем справедливо второе начало термодинамики, отвечают неверно: оно якобы справедливо только для закрытых систем. Такой ответ путает понятие закрытой системы, за пределы которой невозможен обмен веществом, и системы изолированной, за пределы которой невозможен обмен энергией. Все изолированные системы закрыты, но не все закрытые — изолированы. Второе начало термодинамики, запрещающее уменьшение энтропии изолированной системы, не запрещает такового у системы неизолированной, хотя бы и закрытой. (Понятно, что наша Земля и ее биосфера изолированной системой отнюдь не является). Причина указанной путаницы, по-видимому — все то же недопонимание между специалистами разных профессий, в данном случае физиками и химиками. В то время как физики мыслят категориями термодинамики, которая уделяет основное внимание превращению энергии внутри системы, для химиков, как правило, важнее кинетика, которую интересуют в первую очередь превращения вещества.

Из-за этого обстоятельства некоторые химики, и особенно биологи, редко задумываются о различии между собою обратимых и равновесных процессов. Для термодинамики обратимый процесс — это процесс, в котором приращение энтропии равно подведенному к системе количеству теплоты, деленному на температуру системы. Если же в процессе приращение энтропии больше — то такой процесс необратимый. При необратимом процессе общая энтропия мира, понимаемого как «система плюс внешняя среда», неизбежно возрастает и происходит диссипация энергии от более упорядоченных форм движения к менее упорядоченным. При этом энтропия неизолированной системы в необратимом процессе может уменьшаться за счет отвода лишней энтропии во внешнюю по отношению к системе среду.

Другое свойство, по которому различаются процессы в термодинамике и кинетике, и отличное от обратимости/необратимости — это равновесность/неравновесность. Равновесные процессы, характеризуются одинаковой скоростью перехода частиц из одного состояния (пространственного, энергетического, химического и др.) в другое в каждый момент времени. Большинство химических реакций, в том числе лежащих в основании жизни, обратимы, но только при определенных концентрациях исходных веществ и продуктов они находятся в равновесии. С другой стороны, многие равновесные процессы в термодинамике необратимы: примером могут служить изотермические процессы, когда температура системы искусственно поддерживается постоянной — хотя бы за счет обмена энергией с более массивной внешней средой (водяная или воздушная баня).

Принципиальное различие между равновесными и неравновесными процессами заключается в том, что ко вторым такие категории классической термодинамики, как энтропия (а стало быть, и температура, которую определяют через энтропию, а также зависящая от температуры свободная энергия) строго говоря, применимы только для близких к равновесию состояний, ибо только в этом случае можно считать, что дифференциал энтропии является полным. К описанию систем, находящихся в состоянии, далеком от положения равновесия, классическая термодинамика применима плохо, поэтому их поведение обычно описывают с помощью кинетического подхода, который отслеживает изменения состояния частиц (молекул, атомов и др.) в каждой точке пространства-времени.

Хотя формулировка процессов эволюции живого в термодинамических категориях еще не завершена, большинство специалистов вслед за Нобелевскими лауреатами И. Р. Пригожиным и М. Эйгеном уверены, что эволюция жизни — это история существенно неравновесных процессов в существенно открытых системах. Суть неравновесного термодинамического подхода к изучению биологической эволюции — в описании живого как совокупности самовоспроизводящихся тепловых машин (вспомним, что классическая термодинамика успешно описывает превращение хаоса в порядок в тепловых машинах).

Однако, тепловые машины, изучаемые классической термодинамикой, обладали малым количеством обратных связей между своими элементами, из-за чего кинетика частиц рабочего тела (газа) при взаимодействии с элементами ходовой части машины в них описывалась линейными уравнениями, процесс случайных блужданий частиц был марковским (марковским процессом, или цепью Маркова, называется случайный процесс, вероятности разных исходов нового этапа которого зависит только от состояния на текущем этапе, а не на предыдущих этапах) а изменение во времени термодинамических потенциалов рабочего тела — детерминированным и предсказуемым. В живых же системах обилие обратных связей приводит к нелинейности уравнений кинетики для каждого из элементов системы, немарковскому характеру случайных процессов в системе (его исход зависит от всей предыстории случайных блужданий — система «имеет память»), и непредсказуемому поведению даже усредненных параметров всей системы. По мере развития биологии ученые сталкиваются со все менее и менее детерминированными системами, несмотря на что их поведение критическим образом зависит от такого необходимого (детерминированного) явления, как естественный отбор и несмотря на то, что живые системы обладают «памятью», благодаря которой результаты этого отбора запоминаются в геноме.

Квантовая механика приучила ученых смириться с тем, что в мире существуют процессы, результат которых невозможно однозначно предугадать не из-за ограниченности наших умственно-вычислительных способностей, а в силу природы вещей. Такое осознание далось не даром. Эйнштейн, как известно, так и не мог поверить, что «Бог играет в кости». Его интерпретация квантовой механики, высказанная еще в 1930-е годы, в противовес стохастической «копенгагенско-Боровской», предполагала как раз, что мы «не знаем каких-то скрытых параметров» в поведении частиц микромира. Лишь в 1964 году, после смерти и Бора, и Эйнштейна, Дж. С. Беллом было математически показано, что интерпретации Эйнштейна и Бора существенно различны. Именно, результаты пространственно-временных корреляций между двумя связанными общим прошлым частицами «по Бору» и «по Эйнштейну» будут отличаться между собой. Интерпретация квантовой механики по Бору предполагает бóльшую, чем по Эйнштейну, степень коррелированности между состояниями микрочастиц в паре, объединенной общим прошлым (например, в паре летящих в противоположном направлении фотонов аннигиляционного излучения, рожденных в акте аннигиляции позитрона и электрона). И только в1980-е годы была проведена исчерпывающая экспериментальная проверка, кто прав — Бор или Эйнштейн. Оказалось, что все-таки Бор: стохастический характер наблюдаемых фактов о микромире — результат стохастичности самого микромира, а не неизвестности нам каких-то параметров.

Однако, если квантовая механика касалась в основном объектов микромира, то термодинамика и кинетика живых систем открыла нам неквантовые, сугубо макроскопическе объекты, ведущие себя квазихаотически. В живом мире есть системы, состоящие из нелинейно взаимодействующих компонентов; иногда даже число этих компонентов может быть сравнительно малым. Взаимодействие этих компонентов может быть детерминированным, не включающим элементов случайности (естественный отбор, например, есть процесс необходимый). Тем не менее, такие системы могут проявлять достаточно сложное поведение (гораздо более сложное, чем игральная кость при бросании), которое невозможно предсказать.

Хотя в биологической эволюции существенную роль играют случайные процессы, чисто случайным процессом эволюция, разумеется, не является. Без необходимого отбора эволюция бы не привела ни к каким результатам. В этом смысле роль естественного отбора аналогична роли холодильника в тепловой машине, удаляющего лишнюю энтропию за пределы системы. Существенная разница между эволюцией живого и тепловыми машинами состоит главным образом в резкой нелинейности всех процессов эволюции, что приводит к невозможности предсказать результат эволюции, в то время как ход изменения термодинамических потенциалов рабочего тела двигателя легко рассчитать.

Ю. Л. Климонтович, изучая процессы самоорганизации, в 1983 году доказал т. н. S-теорему, которая гласит, что по мере удаления от равновесного состояния вследствие изменения управляющего параметра значения энтропии системы, отнесенные к заданному значению средней энергии, уменьшаются. Как следствие, информация («отрицательная энтропия», или негэнтропия), порождается не «исключительно разумом», как кажется креационистам, а сочетанием случайного изменения состояния системы с последующим необходимым (избирательным) запоминанием результатов этого изменения. Таким образом, на математическом языке были в рамках неравновесной термодинамики описаны введенные еще Дарвином понятия изменчивости, наследственности и естественного отбора. Вдохновленный успехом нелинейной неравновесной термодинамики, Эйген в нобелевской речи даже назвал Дарвина с его идеей естественного отбора «великим физиком».

Такой подход в последние лет сорок не только «помирил теорию эволюции с термодинамикой», но и оказался продуктивным в гораздо более неясной, по сравнению с эволюцией, проблеме абиогенеза — происхождения живого из неживого (см. обзор «Происхождение жизни»). Противники теории эволюции, указывая на ее «слабые места и белые пятна», часто вменяют ей в вину нерешенность проблемы абиогенеза в современной науке. Хотя такие рассуждения — результат непонимания предмета эволюционной биологии (на самом деле она изучает не возникновение живого из неживого, а изменения со временем уже существующих форм живого), вопрос абиогенеза — один из самых «проклятых» в биологии. Гипотеза панспермии, предполагающая занесение на Землю уже способных к размножению и дальнейшей эволюции начальных форм жизни, может оказаться истинной, но это лишь переносит вопрос о возникновении жизни с Земли на другую планету во Вселенной (из современной космологии известно, что Вселенная не вечна, и что в начальные периоды ее эволюции жизни в ней не могло быть никак).

Конечно, невозможно чертить график по одной точке. Поэтому очень трудно строить догадки о деталях происхождения жизни, имея перед глазами только нашу земную жизнь, несомненно, развившуюся из единого корня. И все же успехи в биологии, обреченной быть «царицей наук XXI века» — царицей, которой служат новые концепции математики, физики и химии — позволяют надеяться на то, что люди все же прольют свет на этот вопрос. Тем более что он не только будоражит наше любопытство, но и может послужить ключом к решению важнейших в наше время проблем обеспечения здоровой и обеспеченной жизни каждому землянину.

Н.М.Борисов


Креационизмом в широком смысле называют религиозную веру и философскую концепцию, постулирующую сотворение мира духовным началом (Богом). В этом смысле креационизм, не относясь к науке, тем не менее, не противоречит никакой научной теории, в том числе и теории биологической эволюции, ибо можно допустить, что Бог творил, используя процесс эволюции. Однако, такая точка зрения, (теистический эволюционизм, или эволюционный креационизм), популярная среди многих верующих ученых, а также знакомых с наукой богословов, по-прежнему неприемлема для некоторых «фундаменталистов», настаивающих на необходимости буквального толкования сакральных текстов, повествующих о сотворении мира Богом (в иудаизме и христианстве — это первые главы Книги Бытия). Поэтому среди креационистов немало таких, которые убеждены в отсутствии биологической эволюции и в том, что возраст нашей Вселенной и планеты Земля составляет около 6000–7500 лет.

Автор не считает вполне уместным поднимать в формате научно-популярного жанра богословские вопросы, да и квалификации богослова у автора нет, но, тем не менее, ранее уже замечалось, что присутствие в эволюции случайного фактора не должно смущать верующих. Как мы уже отмечали, случайное в науке — это не предопределенное предшествующими причинами; но поскольку Бог авраамических религий (иудаизма, христианства и ислама) является существом абсолютно потусторонним материальному миру, акты вмешательства Бога в этот мир не могут не выглядеть «случайными» для науки [Гоманьков А. В. Книга Бытия и теория эволюции. В сборнике «Той повеле, и создашася. Современные ученые о сотворении мира». Клин. 1999].

Проставляем даты на геологической летописи, или Как физики геологам помогают

Напрасно многие думают, что все, как видим, сначала Творцом создано. Таковые рассуждения весьма вредны приращению всех наук.

М. В. Ломоносов
1. Как изучать то, чего уже больше нет?
(О методологии наук, имеющих дело с прошлым)

Разгадывая тайны природы, наука проникает в глубины микромира, регистрирует сигналы от экзотических объектов, удаленных от нас на миллионы и даже миллиарды световых лет, одним словом — изучает то, что недоступно повседневному человеческому опыту. Однако существуют области познания, в которых непосредственная экспериментальная проверка принципиально невозможна — например, когда мы изучаем прошлое. В самом деле, как можно заглянуть в давно прошедшие эпохи без машины времени и письменных свидетельств очевидцев? Ведь опыт показывает, что существование человечества ограничено не только в пространстве, но и во времени: так, до Гагарина никто из землян не покидал нашей планеты, а из слоев пород земной коры видно, что на протяжении многих и многих веков существования Земли людей не было и в помине.

Может быть, научными методами прошлое вообще не познаваемо, да и «не пристало» науке заниматься настолько «отвлеченными, неприкладными» проблемами, от которых людям «ни холодно, ни жарко»? Тем не менее, жизнь предостерегает от подобной близорукости. Даже в привычной обстановке мы видим, что прошлое влияет на будущее, в чем состоит принятый в науке в качестве постулата принцип причинности. Другими словами, если мы хотим понять, куда движется наш мир в будущем, нам было бы очень полезно знать его предысторию. И пусть в сложных системах, особенно состоящих из живой материи, будущее не является однозначно предопределенным событиями прошлого (см. главу «Эволюция, случайность, энтропия«), на уровне тенденций и трендов принцип причинности работает и для живых систем. Так нельзя ли использовать принцип причинности для анализа событий прошлого? В самом деле, этот принцип подсказывает нам пути изучения того, чего уже больше нет. Но если оно было — то оно оставило следы, сохранившиеся до наших дней.

Но как интерпретировать эти следы? С похожей задачей часто сталкиваются сыщики — и в реальности, и в детективных романах. Так, расследуя пропажу исчезнувшего поблизости реки лица и обнаружив недалеко от берега реки примятую окровавленную траву, а в этой траве — окровавленный нож, а также цепочку следов к реке и обратно, к дороге, где остался след от стоянки автомобиля, психически нормальный сыщик первым делом предположит, что преступник (преступники), вероятно, убил (убили) жертву, затем утопил (утопили) труп в реке, потом скрылся (скрылись) на автомобиле, а нож забыл (забыли) впопыхах в траве. Может быть, картина преступления была и иной (на обилии «ложных следов» часто строится интрига детектива) — скажем, к реке ходили только замывать кровь, а труп спрятали в багажнике автомобиля и уехали вместе с трупом, а может быть, и убийства не было вовсе, а кровь принадлежит барану, которого резали на шашлыки — но первой версией у следствия будет все-таки утопление трупа (с попыткой найти труп в реке).

А, собственно говоря, почему? Потому что, расследуя преступление, сыщики руководствуются общими для всех людей психологическими законами. Так, если в пылу борьбы легко можно потерять орудие убийства, то непосредственно после совершения убийства первым желанием преступника будет избавиться от трупа, как от наиболее компрометирующей его улики. Таким образом, мы подошли ко второму принципу, определяющему расследование событий в прошлом — к принципу актуализма. Сформулирован он был давно, еще до открытия законов биологической эволюции, однако оказал непосредственное влияние на это открытие. В первой половине XIX века геолог Чарльз Лайель, сопоставив мощные толщи осадочных пород с современными темпами осадконакопления, пришел к выводу, что эти породы аккумулировались весьма долго и медленно. Конечно, сейчас в подходе Лайеля многое кажется слишком прямолинейным, однако общий принцип — отталкиваться при изучении прошлого от общих законов, действующих в настоящем («настоящее — ключ к прошлому», — писал Лайель), остался неизменным до наших дней. Пусть первичная атмосфера Земли была бескислородной — но, скажем, основные газовые законы для нее были все-таки справедливы.

Принцип актуализма сродни методам работы судебно-следственных органов. В нем что-то от презумпции невиновности (подозреваемый считается невиновным до тех пор, пока обвинение не докажет обратного). Ученый, подобно следователю или судье, проверяет сначала «самую похожую на современность модель прошлого», и если она окажется противоречащей опытным данным — выдвигается «более экзотическая» гипотеза, удовлетворяющая двум важным требованиям. Первое, из нее должны вытекать экспериментально проверяемые следствия (иначе это вообще не наука). Второе, эти следствия не должны противоречить твердо установленным законам природы. А если такое противоречие имеется, то гипотеза должна объяснять, почему старая теория работала во всех ранее известных случаях исправно, а для объяснения нового явления оказалась непригодной.

Следует отметить, что и принцип причинности, и принцип актуализма не могут быть «доказаны» ни логически, и ни эмпирически, они просто принимаются как одни из «правил игры в науку», которые позволяют дальше делать умозаключения по законам логики на основании эмпирических данных, а не скажем, каких-либо сакрально-мифологических текстов.

2. Поиски геофизических и астрофизических хронометров в классической науке

Последовательно применяя принцип актуализма, ученые смогли установить возраст планеты Земля, а также продолжительность основных эр, периодов и эпох ее истории. Однако это стало возможным не за одну сотню лет развития науки. То, что геологическая история членится на периоды — было известно еще Николаусу Стено в XVII веке, который заложил основы стратиграфии — изучения последовательности залегания пород в земной коре. Ко временам Лайеля был составлен почти полный, мало отличающийся от современного, каталог временнóй последовательности различных геологических эр, разделяемых на периоды, идентифицированы характерные для периодов породы, а также руководящие (встречающиеся только в этот отрезок времени) ископаемые. Таким образом, в общих чертах была решена проблема относительной геохронологии, определяющей последовательность эр, периодов и эпох. Но какова абсолютная продолжительность каждой из них? На этот вопрос геологи не знали ответа до XX столетия — камни, словно элегантная дама, многозначительно скрывали свой возраст от классической геологии и стратиграфии.

Первые попытки узнать возраст Земли были наивны. Начало этому положили в XVIII веке такие корифеи, как Михайло Ломоносов и Жорж Бюффон. Ломоносов наблюдал за процессами поднятия и опускания земной поверхности, «наступаний» и «отступаний» моря, Бюффон — за остыванием нагретых тел. У Бюффона получился возраст, равный 75 тысяч лет, у Ломоносова — не менее 400 тысяч… Цифры, конечно, далекие от действительности (иначе и быть не могло — принятая в качестве аналогии модель была неадекватна реальности). Но оба ученых осуществили революцию в науках о Земле: они построили модели поведения вещей в прошлом на основе изучения современного опыта, а не вычисляли возраст Земли, считая годы жизни ветхозаветных патриархов, как это делали в донаучную эпоху, опираясь на божественное откровение. И даже такие несовершенные прикидки, как у Ломоносова и Бюффона, дали значение возраста Земли, значительно превышающее ветхозаветное (которое правильно отражает по порядку величины время письменной истории человечества, ибо Ветхий Завет — один из древнейших письменных источников). Идея же оценивать время существования планеты, исходя как из скорости геологических процессов, так и из динамики остывания ее недр, использовалась неоднократно впоследствии, на новом уровне развития научного знания.

Надеясь помочь геологам определить абсолютный возраст Земли, физики XIX века продолжали изыскания. Вильям Томсон (он же лорд Кельвин) усовершенствовал метод Бюффона, проведя более детальные расчеты времени, за которое земная кора могла бы остыть до современного состояния, если изначально она была расплавленной. В итоге это время получилось не в пример внушительнее, чем у Бюффона — порядка 20–40 миллионов лет.

В сотрудничестве с Германом Гельмгольцем Кельвин решил проверить эту цифру, используя данные не о Земле, а о Солнце. С позиций физики XIX века Гельмгольц и Кельвин искали ответ на вопрос «отчего светит Солнце?». Гипотеза сгорания на Солнце химического топлива уже в XIX веке казалась неправдоподобной: химическое топливо должно быстро кончиться. Поэтому ученые XIX века не могли указать ни на какой другой источник энергии Солнца, кроме гравитационного сжатия. Расчеты показывали, что для обеспечения нынешней светимости Солнца оно должно сжиматься с такой скоростью, что около 18 миллионов лет назад радиус Солнце превышал бы радиус земной орбиты.

Хотя оценки Кельвина и Гельмгольца основывались на двух разных эффектах и дали одинаковый по порядку величины ответ, они, тем не менее, казались слишком малыми для геологов. Дело в том, что геологи часто сталкиваются со многими осадочными породами, которые накапливаются или, напротив, выветриваются очень медленно. Поскольку мощность осадочных толщ составляет многие тысячи метров, то из простой экстраполяции, проведенной еще в начале XIX века Лайелем, получалось, что время образования или эрозии многих пород должно занимать не один десяток, если не сотню миллионов лет.

Кто же был прав в попытках оценки возраста Земли — классическая физика или классическая геология? Ведь, если быть до конца откровенным, простое деление мощности пласта на наблюдаемую в настоящее время скорость осадконакопления не является строгим примером применения принципа актуализма. Дело в том, что, во-первых, скорость осадконакопления является величиной непостоянной, она зависит и от времени, и от места накопления осадков. Кроме того — и это не менее важно — существуют процессы, обратные осадконакоплению — это различные типы эрозии пород, которые так же, как и осадконакопление, не стационарны, поэтому определять время отложения пласта с помощью простого деления мощности пласта на скорость осадконакопления не всегда корректно.

Итак, надежный способ определения возраста геологических пород должен удовлетворять, по крайней мере, двум требованиям. Скорость такого процесса должна быть предельно постоянна, не зависеть от внешних условий. Кроме того, должен отсутствовать процесс, обратный тому процессу, который используется для хронометрии.

3. «Ядерные часы» в породах земной коры

Классическая физика и геология XIX не могли указать на такой процесс, равно как и найти источник энергии Солнца и теплоты земных недр. Все вопросы были решены только физикой XX века, изучающей превращения атомных ядер. Такие превращения возможны благодаря тому, что у каждого ядра имеется своя энергия связи, и более выгодно состояние с наибольшей энергией связи. Ядерные силы притяжения между нуклонами (протонами и нейтронами) имеют совершенно особые свойства. В отличие от действующих в макромире гравитационных и электромагнитных сил, ядерные силы являются короткодействующими. Проявляются они только на расстояниях порядка нескольких фемтометров (1фм = 10-15 м) и меньше, но уж если нуклоны оказались на таком расстоянии друг от друга, то ядерное притяжение между ними оказывается так велико, что пересиливает электростатическое отталкивание положительно заряженных протонов.

Из-за таких свойств ядерных сил наиболее крепко связаны нуклоны у ядер в середине таблицы Менделеева (наибольшая энергия связи — у ядер железа). В то же время у легких ядер энергия связи ядра меньше, потому что у таких ядер большая часть нуклонов расположена в поверхностном слое «ядерной капли». Подобно молекулам жидкости в поверхностном слое капли, которые имеют меньше молекул-соседей, чем молекулы в центре капли, и поэтому менее связаны с каплей, нуклоны в поверхностном слое ядра менее связаны с ядром. Напротив, у слишком тяжелых ядер становится существенным электростатическое отталкивание протонов, которое ослабляет связи в ядре. В результате среди легких ядер энергетически выгодными оказывается синтез (слияние), а среди тяжелых — деление (распад на части). Именно это открытие XX века послужило основой создания самого смертоносного оружия, придуманного когда-либо людьми — ядерного в узком смысле, использующего деление тяжелых ядер, и термоядерного, использующего синтез легких ядер (иначе называемый термоядерным синтезом за температуры в миллиарды градусов, необходимые для преодоления электростатического барьера отталкивания ядер при синтезе).

Тем не менее, термоядерному синтезу (конкретно, превращению водорода в гелий) обязана своим существованием не только водородная бомба (не скрою, хотел начать данную фразу с вводного оборота «к счастью», а не «тем не менее». Но потом вспомнил, что у водородной бомбы, в отличие от урановой и плутониевой, пока в истории человечества жертв умышленного применения не было. Насколько такое грозное оружие, способное уничтожить всю цивилизацию за считанные дни, является фактором сдерживания агрессивных инстинктов не лучшей части двуногих в их борьбе за власть и собственность — тема для отдельного размышления, не относящегося к предмету настоящей статьи), но и светимость нашего Солнца и звезд. Расчеты показывают, что звезда — желтый карлик типа Солнца исчерпывает весь водород за время порядка 8–9 миллиардов лет. Таким образом, открытие явление термоядерного синтеза как основного источника энергии звезд сняло один из «проклятых вопросов» в исторической геологии — почему время отложения и разрушения многих горных пород оказывалось значительно больше времени существования Солнца? Гравитационное же сжатие звезд, по современным представлениям, существенно лишь на относительно коротком (порядка ста тысяч лет для звезды, подобной Солнцу) этапе первичного разогрева их недр до температуры, позволяющей идти термоядерным реакциям.

Однако решение проблемы стабильности Солнца на протяжении сотен миллионов лет стало не единственным и даже не главным подарком ядерных физиков геологам. Ядерная физика нашла геохронометр, идеально отвечающий требованиям принципа актуализма — процесс, работающий на протяжении длительных эпох «как часы», в буквальном и переносном смысле слова! Таким процессом оказался радиоактивный распад. В отличие от уже упомянутых здесь термоядерного синтеза и деления тяжелых ядер, как правило, требующих особых условий для своего протекания (сверхвысоких температур, наличия критической массы делящегося материала и др.), радиоактивный распад спонтанен (самопроизволен). При радиоактивном распаде нестабильное материнское ядро, называемое радионуклидом, превращается в дочерний нуклид (дочерний нуклид может быть как стабилен, так и сам радиоактивен. Во втором случае говорят о цепочках радиоактивного распада (радиоактивных семействах), имеющий большую энергию связи, нежели материнский, при этом избыток энергии, как правило, уносится с ионизирующим излучением. В зависимости от типа радиоактивного распада это могут быть ядра гелия (альфа-излучение), электроны или позитроны (бета-излучение), или фотоны с длиной волны порядка 10-10 м и менее (гамма-излучение).

В соответствии с законами квантовой механики, переход от материнского нуклида к дочернему является случайным процессом (о случайных процессах см. главу «Эволюция, случайность, энтропия«), время которого не предопределено начальными условиями. Конфигурация нуклонов в материнском и дочернем нуклиде определяет лишь среднее время жизни радионуклида, а также пропорциональный этой величине период полураспада — время, за которое число радионуклидов в образце уменьшается вдвое. Природа щедро одарила земную кору и мантию радионуклидами, период полураспада которых может достигать многих миллиардов и даже десятков миллиардов лет.

Образуются такие радионуклиды (как правило, тяжелые) путем нейтронного захвата на последней стадии эволюции звезд — при т. н. взрывах сверхновых. В противоположность интуитивным понятиям, историческим термином «взрыв сверхновой» обозначают не начало, а конец эволюции звезды. После выгорания водорода и гелия звезда «сбрасывает» свою атмосферу, при этом наблюдатель с Земли видит вспышку от светящегося газа, превосходящую по яркости звезду до взрыва (как будто «новую звезду не небе»).

Эти радионуклиды (в основном изотопы тяжелых элементов — урана и тория, а также калий-40) вносят существенный вклад в тепловой баланс земных недр (вспомним, что слишком быстрое их остывание составляло в XIX веке проблему для Кельвина; другой важный, но тоже не учтенный Кельвином источник — гравитационная дифференциация вещества в мантии и ядре Земли).

Изотопами элемента Z называются нуклиды, имеющие одинаковое число (Z) протонов, но разное число нейтронов. Таким образом, изотопы различаются атомной массой, например, стабильный углерод-12 и радиоактивный углерод-14, или уран-235 и уран-238, важные для радионуклидного датирования.

Помимо этого, радионуклиды предоставили геологам практически единственный способ судить об абсолютном возрасте пород и абсолютной продолжительности геологических эпох, «проставить даты на палеонтологической летописи». Из-за того, что период полураспада является внутренним свойством спонтанного перехода между состояниями ядра, на него не влияют внешние по отношению к ядру условия, как-то температура, давление, химическое соединение и агрегатное состояние вещества, в которое входят радионуклиды и т. д.

Существенной, а в большинстве случаев главной, проблемой на заре ядерной геохронологии была неизвестность начального содержания, а также выноса и привноса в последующее время материнского и дочернего нуклидов, что делало какие-либо оценки возраста пород крайне затруднительными. В каких-то случаях выручить может то, что дочерний нуклид, как при превращении калия-40 в аргон-40, является газом, который покидает расплав породы при извержении лавы. Однако методы, предполагающие отсутствие дочернего нуклида на момент образования породы, не вполне надежны, особенно для недавно извергшихся пород, так как даже небольшие добавочные количества дочернего нуклида могут привести к огромной погрешности в результате.

К наиболее надежным методам датировок, не только не требующим отсутствия дочернего нуклида, но и имеющим «внутреннюю защиту от ошибок», относятся так называемые методы изохрон. Эти методы основаны на анализе содержания трех нуклидов — материнского радионуклида (M), дочернего радиогенного нуклида (D1), а также другого, нерадиогенного (D2), изотопа того же элемента, что и дочерний нуклид D1 — в разных образцах породы, отличающихся по содержанию материнского нуклида М. На момент кристаллизации расплава породы разные ее образцы могут отличаться по химическому (элементному) составу, однако изотопный состав каждого из элементов будет одинаков для разных образцов (ибо химические свойства элемента мало зависят от изотопа данного элемента). Поэтому изохрона — линия, выражающая зависимость отношения концентраций [D1]/ [D2] от [M]/ [D2] — будет в этот момент прямой, параллельной оси абсцисс (см. рис. 1, круги). По мере превращения нуклида M в нуклид D2 изохрона будет продолжать оставаться прямой (чем больше ядер M содержал образец в начальный момент, тем больше в нем будет накапливаться ядер D1 со временем); и угол ее наклона будет показывать нам возраст породы (рис. 1, треугольники и квадраты). Если же с течением времени будет иметь место вынос или привнос какого-либо из нуклидов (M, D1 или же D2), то изохрона перестает быть прямой линией! Таким образом, метод изохрон обладает «встроенной защитой», которая показывает, «исправны» радионуклидные часы или же они «барахлят».

Рис. 1. Метод изохрон. Для определения возраста магматической породы берут несколько ее образцов, различающихся содержанием материнского радионуклида M. Измеряя (например, с помощью масс-спектрометра) концентрации материнского нуклида M, дочернего нуклида D1, а также нуклида D2, являющегося нерадиогенным изотопом того же элемента, что и нуклид D1, строят графики зависимости [D1]/ [D2] от [M]/ [D2]. При отсутствии выноса и привноса нуклидов за пределы породы такой график является прямой линией — изохроной. Изохрона, построенная по точкам с маркерами-кругами соответствует только что извернувшейся породе, с маркерами-треугольниками — породе возрастом в 0,5 периода полураспада радионуклида M, с маркерами-квадратами — породе возрастом в 1 период полураспада радионуклида M.


Методы абсолютного датирования геологических пород, работая с магматическими породами, элегантно дополняют относительные методы стратиграфии, областью применения которых являются главным образом осадочные породы, опознаваемые по руководящим окаменелостям. Сочетая относительные методы с абсолютными, люди узнали, что Солнечная система существует около 4,6 млрд. лет. 3, 8 млрд. лет назад (начало архея) на Земле уже существовала жизнь. 1,8 млрд. лет назад (конец раннего протерозоя) уже жили первые эукариоты (организмы с клеточным ядром). Около 600 млн. лет назад (эдиакарий, или венд) появились многоклеточные животные. Около 540 млн. лет назад (ранний кембрий) — первые животные с твердым скелетом, почти вслед за ними (около 530 млн. лет назад) — первые позвоночные. Около 365 млн. лет назад (поздний девон) — первые четвероногие животные. Около 220 млн. лет назад (начало верхнего триаса) — первые млекопитающие и первые динозавры. Около 65 млн. лет назад (граница мела и палеогена) динозавры вымирают, освобождая мир для дальнейшей эволюции млекопитающих. Около 2,5 млн. лет назад (конец плиоцена) начинается история человеческого рода, около 10 тыс. лет назад (начало голоцена) люди перешли к земледелию, а спустя несколько тысяч лет — к письменности.

Всего за считанные последние столетия, открыв для себя новые горизонты рационального познания, люди втрое увеличили продолжительность своей жизни, вдесятеро — свою численность на планете. На повестке дня — ликвидация массового голода среди Homo sapiens. Однако одновременно — мы уже едва ли не на большую часть разбазарили кладовую энергетических ресурсов в виде ископаемого топлива, доставшегося нам в наследство от сотен миллионов лет истории биоты Земли. Другие, еще более древние энергетические ресурсы — ядерное топливо в виде урана, наследство от звезд прошлого поколения, мы превратили в орудие массового убийства, грозящее цивилизации гибелью еще до наступления энергетического коллапса. Мы смогли познать многие из обстоятельств пути, по которому сами пришли в этот мир. Сможем ли не уйти из него напрасно, сможем ли оставить себе достойных потомков?

Н.М.Борисов

О других современных методах определения возраста горных пород см.: А.В.Марков. Хронология далекого прошлого

Почему остатки белковых молекул в костях динозавров не являются доказательством молодости Земли

Антиэволюционисты иногда пытаются использовать обнаруженные учеными в некоторых древних ископаемых костях и осадочных породах остатки органических молекул в качестве «доказательства» того, что эти кости на самом деле вовсе не такие древние, а стало быть и вся геохронология нуждается в радикальном пересмотре.


Показать логическую несостоятельность этих утверждений очень легко. Фактически антиэволюционисты заявляют следующее: «Мы предлагаем новый метод определения возраста горных пород и ископаемых остатков: по скорости распада содержащихся в них органических молекул. Органические молекулы всегда распадаются очень быстро. Мы утверждаем, что наш метод более надежен, чем все прочие методы геохронологического датирования, включая радиометрические. Наличие органики в костях или осадочных породах доказывает их молодость, невзирая на результаты всех остальных методов датирования.»

Принципиальная ошибочность этих рассуждений состоит в следующем. Как показано выше в статье «Проставляем даты на геологической летописи, или Как физики геологам помогают«, тот или иной процесс можно использовать в качестве геологического «хронометра» только в том случае, если он идет с постоянной скоростью. Этому условию полностью удовлетворяет радиоактивный распад. Для каждого изотопа характерен строго определенный период полураспада, не зависящий от таких переменчивых факторов, как температура, влажность, давление, химический состав окружающей среды и т. п. Именно поэтому результатам радиометрических датировок доверять можно, а, например, оценкам возраста Земли, основанным на толщине осадочных пород — нельзя, потому что скорость осадконакопления непостоянна и зависит от множества переменчивых факторов. Хорошо известно, что скорость распада органических соединений является в высшей степени непостоянной и зависит от множества переменчивых обстоятельств. В одних условиях органика распадается практически мгновенно (в геологическом масштабе времени), в других она может сохраняться необычайно долго (общеизвестные примеры — египетские мумии или животные, «законсервированные» в вечной мерзлоте). В определенных условиях некоторые органические молекулы могут быть «законсервированы» в осадочных породах на многие миллионы лет. Поэтому до тех пор, пока антиэволюционисты не приведут убедительных доказательств постоянства скорости распада органики и независимости этой скорости от условий среды (а доказательств таких в природе не существует), показания их «хронометра» никоим образом не могут считаться более достоверными, чем результаты радиометрического датирования.

Подробнее обо всем этом см. в статье А.Ю.Журавлева «Вечно неживые»

См. также об остатках белковых молекул в костях динозавров:

Новые данные подтвердили возможность сохранения белков в костях динозавров

Коллаген из костей динозавров — это уже реальность

Коллаген из костей вымерших животных подтверждает родство динозавров с птицами, а мастодонтов — со слонами

Об остатках органических молекул в докембрийских осадочных породах:

Древнейшие следы эукариот и цианобактерий на Земле признаны поздним загрязнением

Животные появились свыше 635 миллионов лет назад

«Несократимая сложность» и бактериальный жгутик

Новая сложность часто рождается в эволюции в результате взаимного приспособления изначально независимых объектов — организмов, клеток или генов. Существующие бок о бок живые системы «притираются» друг к другу, так что, образно говоря, выпуклости одной из них становятся зеркальным отражением впадин другой. И так незаметно, исподволь, из двух самостоятельных объектов рождается нечто принципиально новое — целостная система, одна часть которой теперь уже не может существовать без другой. Антиэволюционисты называют это явление «нередуцируемой (или несократимой) сложностью» и считают, что оно доказывает божественное сотворение всего живого. Примеры «несократимой сложности» окружают нас повсюду. Так, люди очень быстро привыкают к достижениям медицины и техники, становятся зависимыми от них. В недалеком будущем антиэволюционисты, пожалуй, смогут «обосновать» тезис о том, что человек был сотворен одновременно с мобильными телефонами и антибиотиками — ведь он без них не может существовать!

Неизбежным следствием адаптивного (приспособительного) характера эволюции является то, что «несократимая сложность» насквозь пронизывает всю земную биосферу. Организмы постоянно приспосабливаются к среде, в том числе к среде биотической, то есть к другим живым организмам. Именно поэтому подавляющее большинство живых существ, населяющих нашу планету, не может существовать автономно: для выживания им необходимы другие живые существа. По той же самой причине и различные органы (ткани, клетки, молекулы) организма, как правило, не способны нормально функционировать друг без друга. Однако эта взаимозависимость не является абсолютной: в живых системах есть довольно много относительно «свободных» элементов, которые могут меняться без существенного ущерба для целого. Большинство новых биомолекул (например, белков) изначально появлялись именно как такие «свободные элементы», выполнявшие какие-либо самостоятельные, обычно второстепенные функции. Впоследствии они постепенно «притерлись» и «подогнались» к другим элементам системы и стали составлять с ними вместе то, что антиэволюционисты называют «несократимой сложностью».

Частый пример «несократимой сложности» в антиэволюционистских текстах — бактериальный жгутик.

Эволюция бактериального жгутика

(Если ролика не видно на странице, его можно посмотреть здесь)

«Эволюция — ложь, потому что многие великие ученые были верующими»

Разумеется, многие великие ученые, в том числе биологи, были верующими. Но из этого никоим образом не следует, что эволюция — ложь. Как уже неоднократно здесь говорилось, религиозная вера вовсе не мешала и не мешает множеству ученых признавать факт биологической эволюции. Верующими были и многие биологи, заложившие основы современной эволюционной теории (сам Дарвин в молодости был глубоко верующим, а к концу жизни считал себя агностиком). Даже в додарвиновскую эпоху, когда у людей еще в принципе не было никакой разумной альтернативы идее о божественном сотворении всего живого, отдельные великие ученые, оставаясь верующими, высказывались вполне определенно в пользу близости, например, человека к обезьянам. Так, великий Карл Линней, «отец биологической систематики», писал в 1788 году: «Я настаиваю, чтобы вы или кто-нибудь иной указал мне такую черту… с помощью которой можно было бы отличить человека от обезьяны. Сам я совершенно определенно такой черты не знаю. Но если бы я назвал человека обезьяной или наоборот, то был бы неминуемо отлучен от церкви. Однако как натуралист, я, быть может, обязан поступить именно так».

Очень краткие ответы на наиболее часто встречающиеся вопросы

1. Говорят, что эволюция — это теория. С каких пор она стала фактом? Биологическая эволюция — это научный факт, то есть наблюдаемое явление, известное науке и доступное для научного исследования. Научная дисциплина, занимающаяся биологической эволюцией, называется эволюционной биологией, эволюционной теорией и теорией эволюции. В науке под теорией понимают концепцию, описывающую какую-либо обширную область бытия, поддающуюся наблюдению и научному исследованию. Многие научные теории, такие, например, как атомная теория строения вещества, или, собственно, теория эволюции, выдержали столь основательные проверки, что едва ли когда-либо будут отвергнуты. Такие теории в настоящее время ученые уже не проверяют, а лишь дополняют и уточняют. Вещества действительно состоят из атомов, и всё живое действительно возникло в ходе эволюции — это научные факты, описываемые соответствующими теориями. См. также: Чем гипотезы и теории отличаются от доказанных фактов

2. Правда ли, что «Дарвин устарел»? Правда, в том же смысле, в каком устарел любой ученый, живший и работавший в позапрошлом веке. Некоторые предположения, высказанные в свое время Дарвином, впоследствии не подтвердились. Однако самые известные его тезисы, такие, как утверждение, что всё живое возникло в результате постепенной эволюции, ключевым механизмом которой служит естественный отбор, и утверждение, что люди произошли от человекообразных обезьян и состоят с современными обезьянами в близком родстве, подтвердились и нисколько не устарели.

3. Опровергает ли эволюционную теорию «кошмар Дженкина»? «Кошмаром Дженкина» называют известный тезис, выдвинутый британским инженером Флемингом Дженкином. Согласно этому тезису, естественный отбор не может успешно подхватывать возникающие в результате наследственной изменчивости признаки, потому что когда такой признак свойствен лишь одному из родителей, у потомков он будет «растворяться», то есть первому поколению потомков он достанется ослабленным вдвое, второму — ослабленным в четыре раза, и так далее. Бытует легенда, что этот аргумент был для Дарвина настоящим кошмаром, и заставил его всерьез усомниться в своей теории или даже отказаться от нее. Однако документально подверждено лишь то, что Дарвин расценивал аргумент Дженкина как серьеное возражение против его теории (как и ряд других фактов, например, кембрийский взрыв). Но Дарвин надеялся, что дальнейшее развитие науки позволит найти ответы на эти сложные для его теории вопросы, и, безусловно, никогда не отрекался от нее. Ожидания Дарвина полностью оправдались. Как показали достижения генетики, проблема была в том, что ни Дарвин, ни Дженкин не имели представления о материальной природе наследственности и исходили из неверного предположения о том, что «единицы наследственности» не являются дискретными и могут свободно смешиваться и растворяться при скрещивании. В действительности естественный отбор работает не с непрерывно изменчивыми признаками, а с лежащими в основе признаков отдельными генами — дискретными единицами наследственности. Видоизменившийся (мутантный) ген, возникший у какой-либо особи, не разбавляется из поколения в поколение, а достается ровно половине ее потомков в неизменном виде. Поэтому естественный отбор успешно поддерживает определяемые мутантными генами полезные признаки и способствует их распространению в популяциях.

Сам Дженкин сформулировал свое возражение в следующих (очень «расистских», по нашим современным представлениям) словах: «Представим себе белого человека, потерпевшего кораблекрушение на острове, населённом неграми… Наш выживший герой, возможно, станет среди них королём; он убьёт очень много чёрнокожих людей в борьбе за выживание; он заведёт очень много жён и детей, в то время как множество его подданных будут жить холостяками и умрут холостяками… Качества и способности нашего белого человека несомненно помогут ему дожить до глубокой старости, но даже его длинной жизни явно не хватит для того, чтобы кто-то из его потомков в каком-либо поколении стал полностью белыми… В первом поколении будет несколько дюжин смышлёных молодых мулатов, чей ум будет в среднем превосходить негритянский. Нас не удивит, что трон в течение нескольких поколений будет принадлежать более или менее желтокожему королю; но сможет ли поверить кто-то, что население всего острова постепенно станет белым, или пусть даже жёлтым?… В нашем случае признак попал в исключительно благоприятные условия, способствующие его сохранению, — способствующие, и всё же неспособные закрепить и сохранить его.» Сегодня нам известно, во-первых, что превосходство в «уме» белых над неграми, казавшееся очевидным Дженкину и его современникам, определялось не генами, а культурой и воспитанием. Если же у «белого короля» в приведенном примере действительно были бы какие-то аллели (варианты генов), способные повысить репродуктивный успех человека на данном конкретном острове (в данных природных и социальных условиях), то, как показывают простейшие модели популяционной генетики, у естественного отбора были бы хорошие шансы за обозримое время (зависящее от полезности этих аллелей) сделать их всеобщим достоянием среди островитян. Если бы белая кожа заметно повышала репродуктивный успех островитян (например, возникла бы всеобщая «мода» на светлокожих мужей или любовников), то да, через несколько десятков поколений они все с большой вероятностью стали бы белыми, потому что соответствующие аллели, обеспечивающие светлокожесть, достигли бы 100-процентной частоты в популяции.

4. Существуют ли внутренние противоречия в теории эволюции? Принципиальных внутренних противоречий в теории эволюции нет. В современной эволюционной биологии есть ряд противоположных концепций, которые, впрочем, в большинстве случаев не столько противоречат друг другу, сколько описывают разные стороны явлений, и в том или ином смысле одновременно верны. Например, представление о том, что виды возникают постепенно, в действительности не противоречит представлению о том, что они возникают быстро, скачкообразно. Просто в одних случаях бывает первое, а в других — второе. При этом, разумеется, остаются вопросы о том, насколько часто случается то и другое, и как именно возник тот или иной вид. Но ни одно из таких противоречий не затрагивает самых основ эволюционной теории — то есть представлений о том, что все современные виды возникли в результате естественных процессов, среди которых важное место занимает наследственная изменчивость и работающий с ней естественный отбор.

5. Есть ли факты, опровергающие эволюционную теорию? Несмотря на усиленные поиски в течение многих десятилетий, никаких фактов, опровергающих основы эволюционной теории, обнаружено не было. В науке принят, и не без оснований, подход, в соответствии с которым в таких случаях теория рассматривается как доказанная (раз и навсегда доказать что-либо можно лишь в математике, где доказательства строятся на основе бездоказательно принимаемых аксиом, а в естественных науках доказанным считается то, что выдержало серьезные проверки на ложность).

6. Правда ли, что теория эволюции не получила достаточных подтверждений? Факты, изложенные в данной публикации, дают адекватный ответ на этот вопрос.

7. Почему наследственная информация совершенствуется и возрастает в объеме, а не портится в результате мутаций? В этом «вся прелесть» естественного отбора: разные наследственные изменения в разной степени помогают или в разной степени мешают особям выживать и размножаться, но именно те мутации, которые мешают выживать и размножаться, в итоге или не передаются потомкам, или передаются, но реже, чем исходный вариант (и чем полезные мутации), в результате чего порча неизменно отсеивается, а полезное сохраняется и совершенствуется. Рост объема наследственной информации, по-видимому, чаще всего происходит по следующей схеме. Сначала какой-то ген удваивается (удвоение генов — один из распространенных типов генетических мутаций, т. е. «сбоев» при копировании ДНК). В результате в геноме появляется «лишняя» копия гена, которая может свободно накапливать мутации (ведь остается вторая копия, продолжающая выполнять прежнюю функцию). При этом существует вероятность, что мутации придадут меняющемуся гену новое полезное свойство, или что две копии гена «поделят» между собой функции (подробнее см. в заметке Многофункциональные гены — основа для эволюционных новшеств). В итоге в геноме вместо одного функционального гена появятся два гена, выполняющие две разные функции, т. е. произойдет очевидное увеличение объема полезной информации, содержащейся в геноме. Разумеется, все это происходит не мгновенно, а постепенно, за сотни и тысячи поколений.

8. Как могли «из ничего» возникнуть такие сложные органы, как глаз? Правда ли, что эти органы совершенны? Эти органы развились, поэтапно усложняясь, из более простых структур. У современных организмов можно наблюдать множество вариантов строения таких структур, занимающих промежуточное положение по уровню сложности между простейшими и наиболее сложными из известных науке. Подробное изучение строения и развития любого сложного органа у организмов из разных групп всегда позволяет разобраться, хотя бы в общих чертах, как такой орган мог сформироваться в ходе эволюции. Кроме того, ни один сложный орган никак нельзя считать совершенным: все они обладают ограниченными возможностями и чертами строения, которые накладывают подобные ограничения. Частично такие черты связаны с физическими и химическими свойствами структур, входящих в состав органа, а частично — с наследием предков. Например, в человеческом глазу сетчатка как бы вывернута наизнанку: светочувствительные клетки обращены не наружу, к источнику света, а внутрь, вглубь головы. В результате свет, прежде чем достигнуть этих клеток, проходит через клетки, лежащие над ними, и частично поглощается. Это делает глаза менее чувствительными. Технически вполне возможны глаза более совершенные, улавливающие максимум попадающих в них лучей (и такие глаза действительно существуют — у головоногих моллюсков). Но у наших далеких предков сложились основы нынешней, несовершенной системы, и хотя она сильно усовершенствовалась впоследствии, естественным путем она никак не могла стать идеальной — и не стала (подробнее см. в разделе «Морфологические доказательства«).

9. Можно ли наблюдать эволюцию? Да. Эволюцию наблюдать не только можно, но даже не очень сложно. Например, воздействуя определенным ядом на микроорганизмы (у которых быстро сменяются поколения, и поэтому естественный отбор работает с большой скоростью), можно довольно быстро выводить культуры этих микроорганизмов, устойчивые к данному яду (менее устойчивые погибают, а более устойчивые выживают и оставляют потомство, поэтому в ряду поколений устойчивость к яду возрастает). Многолетние наблюдения над многоклеточными организмами тоже позволяют наблюдать эволюционные изменения, как в искусственных условиях, так и в природе (см. раздел «Наблюдаемая эволюция«).

10. Правда ли, что люди не вывели ни одного нового вида? Нет, это неправда. Выведение новых видов — задача непростая (в природе на это требуются, как правило, десятки и сотни тысячелетий), но она не раз увенчивалась успехом. Один из самых известных примеров — черноплодная рябина, выведенная Иваном Владимировичем Мичуриным (посредством скрещивания двух других видов растений). Удавалось получать новые виды и без скрещивания разных видов. Видом биологи обычно называют совокупность особей, оставляющих плодовитое потомство друг с другом, но в естественных условиях не скрещивающихся с другими особями. Домашних собаку и кошку нередко рассматривают как виды, отдельные от волка и европейской лесной кошки, из которых они выведены. Скрещивание домашних особей с их дикими родственниками возможно, но в естественных условиях происходит редко. Если бы из многочисленных современных пород собак сохранились, например, лишь самые маленькие, они бы уже никак не смогли скрещиваться с волками. Переход между собакой и волком остается довольно плавным лишь потому, что люди искусственно поддерживают разные промежуточные формы. Неудивительно, что в природе такое происходит редко, ведь разные формы в порядке вещей имеют разные шансы выжить, и менее жизнеспособные без искусственной поддержки оказываются вытеснены более жизнеспособными. Подробнее см. в разделе «Изменения видов при доместикации (от искусственного отбора к естественному)«.

11. Хватает ли времени для эволюции наблюдаемых сегодня форм естественным путем? По-видимому, хватает. Новые данные постоянно позволяют уточнять научные представления о скорости эволюционных процессов, и чем больше об этом известно, тем лучше это согласуется с данными о хронологии эволюционных изменений. Например, известная скорость появления новых мутаций (изменений ДНК) у людей (порядка 100–200 новых мутаций у каждого новорожденного) хорошо согласуется с имеющимися генетическими различиями между человеком и шимпанзе (порядка 50–80 миллионов различий), продолжительностью поколения (порядка 15 лет) и временем существования последнего общего предка человека и шимпанзе (судя по палеонтологическим данным, он жил 6–7 млн лет назад): 100 мутаций * 6 млн. лет / 15 лет = 40 млн различий, возникших в каждой из двух линий (поскольку у предков шимпанзе мутации тоже происходили, это число нужно умножить на два)..

12. Правда ли, что для того, чтобы методом случайного перебора всех возможных вариантов создать сложную биологическую молекулу (например, белка гемоглобина), не хватило бы всего времени существования Вселенной? Истинная правда, однако естественный отбор создает такие молекулы вовсе не перебором всех возможных вариантов. Естественный отбор работает совершенно по другому принципу. Молекула размножается в огромном числе копий, причем некоторые из них из-за мутаций немного отличаются от исходной. Затем отбор выбирает из получившися вариаций самые удачные, и они снова размножаются с небольшими вариациями. Из этих вариаций снова отбираются самые удачные, и так далее. Простейшие компьютерные модели показывают, что «создать» молекулу гемоглобина случайным перебором всех возможных вариантов аминокислотных последовательностей практически невозможно даже на самом сверхскоростном компьютере. Однако программа, имитирующая алгоритм естественного отбора, создает такую молекулу очень быстро (подробнее см. в Главе 3 книги Р. Докинза «Слепой часовщик»).

13. Правда ли, что естественным отбором нельзя объяснить возникновение полового размножения? Нет, это выдумка. Современные представления о возникновении полового размножения исходят, как и вся современная биология, из эволюционных посылок, и в рамках этих представлений возникновение полового размножения оказывается не только возможным, но даже необходимым. Процессы, по сути аналогичные половому размножению многоклеточных животных и растений, возникали в ходе эволюции неоднократно. Половое размножение имеет свои недостатки перед бесполым, в чем-то затрудняя жизнь и выживание тем, кому оно свойственно, но имеет и несомненные достоинства, которые, особенно для сложно устроенных организмов, обычно с лихвой перевешивают эти недостатки (подробнее см. в заметке: Опыты на червях доказали, что самцы — вещь полезная).

14. Почему обезьяны сейчас не превращаются в людей? Один и тот же вид не может независимо возникнуть дважды. Это так же невероятно, как невероятно, что два разных автора напишут независимо слово в слово одно и то же стихотворение. Развивая это сравнение, можно обратить внимание, что если для авторов-современников такое еще и можно себе представить, то для авторов из разных эпох, пишущих на разных языках, это уже совершенно немыслимо. Современные обезьяны отличаются от тех древних обезьян, от которых произошел человек разумный. Исторические обстоятельства, позволившие нашему виду сформироваться таким, какой он есть, ушли в прошлое, и даже если потомки каких-то из ныне живущих видов разовьются когда-нибудь в существ, не менее разумных, чем мы, совершенно невероятно, что они будут во всем такими же, как мы. Данный вопрос обычно диктуется ошибочным представлением о том, что человек — своего рода «венец эволюции», к появлению которого вся эволюция изначально и стремилась. Эти представления не разделяются современной наукой. Большой мозг — крайне «дорогостоящий» орган (в частности, он потребляет очень много энергии), и поэтому виды с большим мозгом в эволюции появляются довольно редко (кроме человека, очень большой мозг характерен для слонов и китообразных). Подробнее см. в заметке А.В.Маркова «Почему не все обезьяны эволюционировали в человека?«

15. Действует ли в научных кругах запрет на критику эволюционной теории? Нет. Напротив, критические замечания, касающиеся различных ее положений, постоянно публикуются в научных изданиях. Люди, отрицающие эволюцию с позиций невежества, утверждают, что их аргументы несправедливо замалчиваются. В современном научном журнале сложно опубликовать статью, в которой, например, отрицается сам факт эволюции, или утверждается, что историческое развитие живой природы заняло несколько тысячелетий, или что эволюция не связана с естественным отбором. Но не менее сложно опубликовать статью, в которой утверждается, что Земля плоская, или что вещества не состоят из атомов. Подобные концепции когда-то высказывались и серьезными учеными, но в наши дни они отвергнуты наукой на основании огромного количества данных, и обсуждать их снова значило бы возвращаться к пройденным этапам, вместо того, чтобы двигаться вперед.

16. Являются ли антиэволюционизм (креационизм) и его разновидность — «теория разумного замысла» («intelligent design») наукой? Нет. Это религиозные концепции, не пользующиеся или непоследовательно пользующиеся научным методом. Даже наиболее наукообразные из таких концепций неизменно прибегают к объяснению наблюдаемых явлений через постулируемое сверхъестественное. Это делает такие концепции принципиально непроверяемыми. Наука не имеет дела с принципиально непроверяемыми утверждениями. Научный метод предполагает поиск естественных причин, лежащих в основе наблюдаемых явлений. Существует ли вообще сверхъестественное — вопрос не научный, а философский, мировоззренческий. Какое бы разумное определение мы ни дали сверхъестественному, сверхъестественное неизбежно окажется вне компетенции естественных наук.

17. Думают ли животные? Да. Хотя ни одно животное и не способно мыслить на уровне умственно полноценного взрослого человека, многим животным свойственны сходные с человеческими формы мышления. Наших ближайших родственников, шимпанзе и горилл, можно даже научить говорить (на языке жестов, потому что человеческую речь им не позволяют воспроизводить особенности строения гортани), и наиболее способные из них демонстрируют умственные способности, сравнимые со способностями двух-трехлетнего человеческого ребенка. Интеллекту животных посвящено множество научных исследований и публикаций (см., например: З.А.Зорина, И.И.Полетаева. Элементарное мышление животных).

18. Совместимы ли теория эволюции и христианство? На этот счет нет единого мнения. Однако среди христиан есть немало людей, сведущих в биологии и не отвергающих теорию эволюции, а среди эволюционистов есть немало глубоко верующих христиан. Есть они и среди авторов данной публикации (подробнее см. во «Вступительном слове«).

19. Правда ли, что Дарвин перед смертью отрекся от своих взглядов? Нет, это вымысел. Вскоре после смерти Дарвина леди Хоуп сообщила публике, что посетила ученого на смертном одре, и что он отрекся от эволюции и принял Христа. Однако дочь Дарвина, Генриетта, пробывшая с ним все последние дни, сказала, что леди Хоуп ни разу не посещала Дарвина в течение его болезни, что Дарвин вообще едва ли когда-либо с ней встречался, и что он не отрекался от своих научных идей (Clark 1984, 199; Yates 1994). Впрочем, данный «факт» не имел бы принципиального значения, даже если бы был правдой. Теория эволюции основана на огромном количестве научных фактов, происходящих из разных областей науки, а не на авторитете какой-либо отдельной личности или личностей. См.: Greig, Russell, 1996. Did Darwin recant? Creation 18 (1): 36–37;. http://www.answersingenesis.org/docs/1315.asp; Yates, Simon, 1994. The Lady Hope story: A widespread falsehood; http://www.talkorigins.org/faqs/hope.html.

20. Почему у эволюционистов всегда такой высокомерный тон, почему они так неуважительно отзываются о своих оппонентах — антиэволюционистах? Это — нарушение научной этики! Научная этика тут ни при чем, потому что антиэволюционисты уже лет 80 как находятся полностью вне науки. Они даже не пытаются публиковать свои тексты в научных журналах (за редчайшими исключениями). Они не проводят никаких научных исследований. Отношения между учеными и антиэволюционистами такие же, как между преподавателем, пытающимся читать лекцию по истории Древнего Рима, и кучкой хулиганов на задних партах, которые не дают ему вести урок своими криками «Все это ложь, никакого Рима не было, Юлий Цезарь жил 100 лет назад и был на самом деле Наполеоном, читайте академика Фоменко!» Конечно, каждая человеческая личность заслуживает уважения просто в силу того, что это человеческая личность. Но поступки антиэволюционистов, их нападки на науку и попытки насаждения воинствующего невежества никакого уважения не заслуживают и должны разоблачаться без всякого снисхождения. В науке принято называть вещи своими именами. «Аргументация» антиэволюционистов с научной точки зрения не представляет ни малейшего интереса. Это не более чем смесь назойливо повторяющихся старых вопросов (на которые наука давно уже ответила), прямой лжи, нелепых обвинений (например, в подделках, в мировом заговоре эволюционистов и т. п.) и жонглирования выдернутыми из контекста цитатами. Мы бы вообще не стали обращать внимания на все это, если бы пропаганда антиэволюционизма не начала находить отклик у населения многих стран мира (см.: Популярность креационизма в Европе объясняется не религиозностью, а научной безграмотностью). Мы не можем позволить шарлатанам и невеждам насаждать антинаучные взгляды среди нормальных людей. Поэтому и приходится отрываться от основной работы и писать вот такие тексты, доказывая вещи, давным-давно доказанные и, с точки зрения науки, абсолютно бесспорные.

21. Почему авторы этой публикации ссылаются на Ричарда Докинза — ведь всем известно, что это очень «попсовый» автор, и к тому же воинствующий атеист? Ричард Докинз — не «попсовый» автор, а один из крупнейших современных биологов-теоретиков. Он внес большой вклад в развитие нескольких важнейших научных идей (например, концепций «эгоистичного гена» и «расширенного фенотипа»), которые во многом определяют облик современной биологической «картины мира». Мировое научное сообщество по достоинству оценило вклад Докинза в развитие науки. Ярким подтверждением этому является книга, выпущенная издательством Оксфордского университета в 2006 году. Книга называется: «Ричард Докинз: ученый, изменивший наш образ мыслей» (Richard Dawkins: How a scientist changed the way we think) и представляет собой сборник статей 26 известнейших ученых, в которых подробно обсуждается вклад Докинза в развитие научной мысли и критически разбираются его идеи. Миф о «попсовости» Докинза распространяется антиэволюционистами, потому что это чуть ли не единственный контраргумент, который они смогли придумать против убийственной критики их взглядов, содержащейся в книгах Докинза. Помимо научных работ, Докинз пишет научно-популярные книги, цель которых — объяснить простыми словами для широкой аудитории важнейшие факты и идеи, лежащие в основе современной эволюционной биологии. Подавляющее большинство критиков (разумеется, кроме принадлежащих к лагерю антиэволюционистов) сходятся на том, что популярные книги Докинза написаны на очень высоком научном уровне и содержат минимальное количество неизбежных в этом жанре упрощений и неточностей. Что касается атеистических взглядов Докинза, то они изложены в отдельной книге («Бог как иллюзия»), которая не имеет отношения к обсуждающемуся здесь вопросу — реальности биологической эволюции, и нами здесь не цитируется.

22. Что такое «полистраты»? Так креационисты называют встречающиеся в палеонтологической летописи ситуации, когда ствол ископаемоего дерева, стоящий вертикально, проходит сквозь значительную толщу осадочных пород. «Полистраты» возникают при очень быстром осадконакоплении, например, при крупных наводнениях. Квалифицированные геологи без труда отличают осадочные толщи, сформировавшиеся практически одномоментно во время наводнений (или, например, в результате обвалов и оползней), от тех, которые сформировались постепенно, в результате постепенного накопления осадков на дне моря или озера. Проблема «полистратов» подробно рассмотрена на английском языке на сайте talkorigins.org.

11. Некоторые более сложные доказательства


Эволюционная теория изо дня в день подтверждается научно-исследовательской практикой

Практикующих биологов убеждают в реальности эволюции не только (и даже не столько) факты, изложенные в предыдущих разделах (не каждый биолог держит их постоянно в голове), сколько повседневная научно-исследовательская практика, которая, как известно, критерий истины. Эволюционная теория — весьма эффективное практическое средство, позволяющее предсказывать новые, еще не открытые факты, целенаправленно искать их и находить. В предыдущих разделах мы уже упоминали о нескольких предсказаниях такого рода, которые направили работу исследователей в определенную сторону (т. е. стали исследовательской программой) и привели к успеху, то есть к открытию новых фактов, прежде неизвестных, но предсказанных теорией. К числу самых известных примеров относится предсказанная Дарвином длительная история жизни на Земле в период, предшествовавший «кембрийскому взрыву«— и триумфальный успех палеонтологии докембрия в XX веке; предсказанное и подтвержденное основателями молекулярной генетики единство генетического кода всех живых организмов (см. раздел «Молекулярно-генетические и биохимические доказательства«), многочисленные предсказанные и найденные ископаемые переходные формы (например, тиктаалика искали совершенно целенаправленно в отложениях строго определенного возраста, там, где была «дырка» между уже известными переходными формами от рыб к четвероногим), см. раздел «Палеонтологические доказательства«.

Но убежденность биологов основана не столько на этих хрестоматийных и широко разрекламированных триумфах эволюционной теории, сколько на бесчисленном множестве открытий меньшего масштаба, но зато повседневных и повсеместных, которые были выполнены по алгоритму «предсказал — проверил — подтвердил». Рассмотрим пару примеров, взятых наугад из статей, опубликованных в течение последнего месяца (эти строки написаны в феврале 2010 г.)


1. Как коловратки спасаются от паразитов. Эволюционная теория позволила дать убедительный ответ на очень непростой вопрос о том, почему в природе так широко распространено половое размножение (ведь гораздо проще почковаться или размножаться партеногенетически, как некоторые организмы и делают). Суть этого ответа в том, что половое размножение резко повышает эффективность естественного отбора, ускоряя отбраковку вредных и накопление полезных мутаций. Этот эффект полового размножения был предсказан теоретически, а затем подтвержден экспериментально. История о том, как эволюционная теория позволила понять, зачем нужно половое размножение, тоже очень подходит нам для иллюстрации основной идеи данного раздела (подробности см. в заметке «Опыты на червях доказали, что самцы — вещь полезная«), но мы сейчас хотим рассказать о другом, более частном исследовании.

Способность полового размножения ускорять адаптивную (приспособительную) эволюцию особенно важна для борьбы с паразитами, которые ведут со своими жертвами нескончаемую «эволюционную гонку вооружений» (см.: Современные паразиты опаснее прошлых и будущих).

Бделлоидные коловратки — единственная большая группа животных, в которой утрата полового размножения не привела к быстрому вымиранию. Все остальные группы, отказавшиеся от полового размножения, представляют собой маленькие концевые веточки (или небольшие пучки веточек) на эволюционном дереве. Это означает, что такие группы обычно вымирают, не успев дать начало большим таксонам (семействам, отрядам или классам). Теория предсказывает, что важной причиной вымирания бесполых популяций являются паразиты, обгоняющие их в эволюционной гонке и доводящие до полного истребления.

Заметьте, вот еще одна маленькая деталь, показывающая силу эволюционной теории. Мы берем одну эволюционную модель (объяснение, зачем нужно половое размножение), выводим из нее проверяемое следствие (группы животных, отказавшиеся от полового размножения, должны в большинстве случаев быстро вымирать), и затем проверяем это предположение при помощи другой эволюционной модели (в данном случае это многочисленные независимые методы построения эволюционных деревьев). Если обе наши модели правильные, мы должны увидеть, что большинство бесполых групп животных представляют собой отдельные концевые веточки на эволюционном дереве или маленькие концевые пучки веточек. Именно это мы и видим. Тем самым добавляется еще одна капелька в давно уже переполненную чашу нашей уверенности в реальности эволюции.

Бделлоидные коловратки, однако, обходятся без полового размножения уже как минимум 40 миллионов лет. За это время они успели стать довольно разнообразной группой, которой биологи придают ранг класса и которая включает более 450 современных видов. Следовательно, если теория верна, у коловраток должно быть какое-то «тайное оружие» против паразитов, позволяющее им процветать невзирая на отсутствие полового размножения. Биологи Кристофер Уилсон и Пол Шерман из Корнеллского университета (США) предположили, что бделлоидные коловратки спасаются от паразитов благодаря трем своим уникальным свойствам. Во-первых, бделлоидные коловратки умеют переносить полное высыхание, причем жизнеспособность в высушенном состоянии у них сохраняется до 9 лет. Во-вторых, в сухом виде они очень легко переносятся ветром (именно поэтому многие виды бделлоидных коловраток имеют глобальное распространение). В-третьих, они моментально «отмокают» и начинают расти и размножаться, стоит им попасть в любое влажное место, будь то эфемерная маленькая лужа или пучок сырого мха.

Главными врагами бделлоидных коловраток являются паразитические грибы рода Rotiferophthora. Это специализированные паразиты, вызывающие смертельное заболевание у бделлоидных коловраток и ни у кого больше. Гриб убивает коловратку, прорастает наружу через ее покровы и рассеивает споры, которые поедаются другими коловратками и заражают их. Заболевание характеризуется 100-процентной смертностью — это как раз то, чего и следует ожидать в случае проигранной эволюционной гонки.

Сверху — здоровая бделлоидная коловратка, снизу — то, что от нее остается после заражения грибом Rotiferophthora


Исследователи решили проверить, могут ли коловратки избавиться от паразитов при помощи высыхания и последующего перенесения ветром. Коловраток рассаживали по одной в чашки Петри и давали им спокойно жить и размножаться в течение 9 дней. За это время каждая коловратка успевала дать начало маленькой популяции из нескольких десятков особей. После этого во все чашки, кроме контрольных, добавляли споры смертоносного гриба Rotiferophthora angustispora. Гриб начинал бурно размножаться и истреблял всех коловраток в чашке за 12–15 дней. Затем ученые попробовали высушивать зараженную популяцию коловраток через три дня после заражения и оставлять в сухом виде на неделю. После этого в чашку снова наливали воды. Поначалу казалось, что всё идет нормально: коловратки оживали и выглядели здоровыми, а вода была незаразной для других коловраток, что свидетельствует об отсутствии живых грибных спор. Но уже через 48 часов из тел мертвых коловраток начинали показываться гифы уцелевших грибов, они рассеивали споры, и через 2–3 недели популяция коловраток погибала. Оставив зараженных коловраток в высушенном виде не на одну, а на две недели, ученые получили точно такой же результат: после добавления воды оживали не только коловратки, но и грибы, и всё кончалось плачевно.

Однако результаты получились совсем другими, когда популяции высушивали на более долгий срок — 3, 4 или 5 недель. В этом случае большинство «размоченных» популяций оставались свободными от грибной инфекции вплоть до конца эксперимента (в течение 20 недель). После трехнедельного высушивания грибы «ожили» только в 40 % подопытных популяций, после четырехнедельного — в 15 %, пятинедельного — в 9,5 %. Таким образом, коловратки выдерживают высыхание лучше, чем их паразиты. Ясно, что эта способность должна помогать им бороться с грибной инфекцией в природе.

Помогает ли им в этом также и распространение при помощи ветра? Ученые соорудили камеру, в которой дул легкий ветерок, и поставили туда чашку с зараженной и только что высушенной популяцией коловраток. В чашке были также естественные субстраты: мох и ил. На расстоянии 30–40 см были установлены 24 пустые чашки. За неделю в эти чашки нанесло ветром в общей сложности 5 мг сухого материала. Чашки залили водой, и в 17 из них вскоре обнаружились ожившие коловратки. В семи из этих семнадцати популяций вскоре появился гриб-паразит, который расправился с коловратками, как обычно, в течение 2–3 недель. Однако остальные 10 популяций оказались свободными от гриба и чувствовали себя нормально до окончания эксперимента.

Таким образом, без ветра коловраткам требовалось пролежать в сухом виде не менее трех недель, чтобы избавиться от инфекции. Переносимые ветром, коловратки освобождались от гриба гораздо быстрее. Следовательно, ветер действительно может помогать коловраткам спасаться от паразита. Видимо, это связано с тем, что коловратки лучше приспособлены к распространению при помощи ветра, чем гриб. Здоровые коловратки, высыхая, превращаются в компактные (менее 300 мкм) и очень легкие овальные тельца, которые называют «бочонками» (tuns). «Бочонки» исключительно хорошо переносятся ветром. Гриб же приспособлен в основном к распространению через воду. В контрольном эксперименте, когда зараженную популяцию не высушивали и расселяли капельками воды, все дочерние популяции оказались зараженными и вскоре погибли.

Очевидно, что в природе коловраткам и их паразитам часто приходится сталкиваться и с более долгими засухами, и с переносом на гораздо большие расстояния, чем в проведенных экспериментах. Полученные результаты показали, что коловратки ухитряются выжить без полового размножения благодаря тому, что хорошо научились играть с паразитами в прятки. Таким образом, предсказанное эволюционной теорией «тайное оружие» коловраток было успешно найдено благодаря целенаправленному поиску. Источник: Christopher G. Wilson, Paul W. Sherman. Anciently Asexual Bdelloid Rotifers Escape Lethal Fungal Parasites by Drying Up and Blowing Away // Science. 2010. V. 327. P. 574–576.


2. Взаимопомощь среди сперматозоидов. Полиандрия — спаривание самки со многими самцами — приводит к острой конкуренции между сперматозоидами за право оплодотворить яйцеклетку. Эту конкуренцию можно рассматривать с двух точек зрения: отдельных сперматозоидов (с одинарным набором хромосом) и целых самцов (с двойным набором). Эволюционная гонка вооружений, порождаемая «спермовыми войнами», ведет к выработке специфических адаптаций на обоих уровнях. Как правило, самцов тех видов, для которых характерны спермовые войны, легко опознать по крупным семенникам. Чем больше они производят спермы, тем выше их шансы оставить потомство (типичный пример — шимпанзе; у человека, напротив, маленькие семенники — это свидетельствует о том, что в эволюции гоминид спермовые войны не имели большого значения). Сперматозоиды, со своей стороны, тоже вырабатывают специфические приспособления для победы в отчаянной гонке, в которой генам-победителям достается шанс на бессмертие. Одним из таких приспособлений является способность сперматозоидов объединяться в группы, склеиваясь «головка к головке» или «головка к хвосту». Смысл в том, что такие группы быстрее движутся в половых путях самки и обгоняют конкурентов-одиночек.

В кооперации сперматозоидов присутствует элемент альтруизма, ведь из всей группы только один сперматозоид может передать свои гены следующим поколениям, а все остальные жертвуют собой, чтобы ему помочь. Но они, скорее всего, не знают заранее, кто именно окажется счастливчиком, а у сперматозоидов-одиночек шансы на успех всё равно ниже, чем у любого члена группы.

Однако при полиандрии выгодно помогать не всякому сперматозоиду, а только родственнику, то есть сперматозоиду того же самца. Сперматозоиды одного самца имеют в среднем по 50 % одинаковых генов, поэтому, согласно правилу Гамильтона (см.: Эволюция кооперации и альтруизма), каждому сперматозоиду выгодно пожертвовать частью собственных шансов на успех ради родственников, если их суммарный выигрыш от этого более чем вдвое превысит его проигрыш. Совсем другое дело, если речь идет о чужих сперматозоидах: помогать им во вред себе совершенно невыгодно.

Таким образом, эволюционная теория предсказывает, что у видов, для которых характерна полиандрия, отбор может поддержать способность сперматозоидов отличать родню от чужаков и кооперироваться только со «своими».

Для проверки этого предсказания ученые из Гарвардского университета (США) изучили поведение сперматозоидов у двух близкородственных видов американских хомячков рода Peromyscus, которых в Америке называют «оленьими мышами» (deer mice) (см. о них в заметке: Эволюция защитной окраски у мышей изучена на молекулярном уровне). Для одного из видов (P. maniculatus) характерна полиандрия, причем между спариваниями одной самки с двумя разными самцами проходит порой меньше минуты. Самки второго вида (P. polionotus) более целомудренны и предпочитают устойчивые семейные связи. В соответствии с этим и семенники у самцов P. maniculatus втрое крупнее, чем у P. polionotus.

Для начала исследователи убедились, что у обоих видов сперматозоиды склонны объединяться в группы. Эти группы, как показали эксперименты in vitro (в пробирке), плавают в среднем со скоростью 127 микрометров в секунду и уверенно обгоняют одиночек, средняя скорость которых составляет лишь 110 мкм/с.

После этого были проведены эксперименты на избирательность объединений. Сперматозоиды разных особей красили двумя разными флюоресцентными красителями (красным и зеленым), а затем следили за их поведением в искусственной среде. В качестве контроля в этих опытах использовались сперматозоиды одного самца, половина из которых была выкрашена в красный, половина — в зеленый цвет. Подсчитывался процент одноцветных сперматозоидов в каждой группировке.

Оказалось, что если смешать сперматозоиды двух видов, то они образуют преимущественно конспецифичные группировки, то есть объединяются в соответствии с видовой принадлежностью. Значит, способность к различению «своих» и «чужих» у сперматозоидов имеется. Во втором эксперименте смешали сперматозоиды двух разных самцов P. maniculatus. Они тоже образовали одноцветные группы по родственному принципу. Но когда экспериментаторы смешали сперматозоиды двух самцов моногамного вида P. polionotus, для которых спермовые войны не актуальны, сперматозоиды стали образовывать смешанные красно-зеленые группировки. Таким образом, эксперименты полностью подтвердили теоретические ожидания: у вида с полиандрией сперматозоиды разных самцов различают друг друга и объединяются только со «своими», а у моногамного вида сперматозоиды не имеют такой избирательности. Как и в предыдущем примере, неизвестный ранее факт — умение сперматозоидов группироваться по родственному принципу — был обнаружен в результате целенаправленного поиска. Эволюционная теория подсказала исследователям, что искать и где, и привела их к успеху. Источник: Heidi S. Fisher, Hopi E. Hoekstra. Competition drives cooperation among closely related sperm of deer mice // Nature. Advance online publication 20 January 2010.

Постоянно сталкиваясь с подобными ситуациями, биологи раз за разом убеждаются в действенности эволюционных моделей. Стоит ли удивляться, что среди биологов сегодня практически не осталось антиэволюционистов?

Cui prodest?

«Кому выгодно?» — один из полезнейших принципов сыскного дела. Он приложим и к биологии. Эволюционная теория предсказывает, что адаптации (приспособления) организмов должны быть выгодны в первую очередь генам (аллелям), отвечающим за эти признаки. «Выгода» в эволюции означает «репродуктивный успех», то есть успешное размножение. Если признак, определяемый данным аллелем, способствует более успешному распространению данного аллеля в популяции (по сравнению с другими, конкурирующими аллелями, определяющими альтернативные варианты данного признака), то аллель будет распространяться (будет «поддержан отбором») и в конце концов может вытеснить конкурирующие аллели из генофонда популяции. Таким образом, в самом простом «базовом» случае эволюция работает строго в интересах «эгоистичного гена». Однако гены почти всегда действуют не поодиночке, а слаженными «коллективами». Каждый такой коллектив — геном отдельного организма — имеет общие интересы, которые состоят в том, чтобы несущий их организм оставил как можно больше жизнеспособного и плодовитого потомства. Поэтому эволюция обычно (почти всегда) работает также и в интересах «эгоистичной особи». Иногда складываются более сложные ситуации, когда «эгоистичному гену» выгодно пожертвовать одной или двумя своими копиями ради того, чтобы повысить репродуктивный успех других своих копий. В этом случае эволюция начинает работать в интересах другой особи или группы особей (подробнее см.: Эволюция кооперации и альтруизма).

Таким образом, предсказания эволюционной теории относительно того, кому должны быть выгодны адаптации, напоминают три закона роботехники Айзека Азимова:

1) Адаптация должна быть выгодна генам, которые ее определяют (кодируют).

2) Адаптация должна быть выгодна особи, несущей эти гены в своем геноме, если это не противоречит первому закону.

3) Адаптация должна быть выгодна родным и близким данной особи, если это не противоречит первому закону (противоречие второму закону допускается).

Это, конечно, крайне упрощенные и не совсем корректные формулировки, но в рамках популярного текста их можно рассматривать как допустимые. Из всего этого следуют довольно интересные проверяемые следствия, подтверждаемые многочисленными фактами.

Например, теория предсказывает, что могут существовать «обнаглевшие» эгоистичные гены (или небольшие компании генов), действующие исключительно в своих корыстных интересах и в ущерб интересам того организма, в котором они находятся. Это может наблюдаться только в том случае, если ген имеет возможность размножаться независимо от размножения целого организма (иначе их эволюционные интересы будут полностью совпадать — как оно обычно и бывает — и тогда «эгоизм» гена не сможет проявиться). За примерами далеко ходить не надо — это, прежде всего, вирусы. Есть веские основания полагать, что по крайней мере некоторые группы вирусов — это «одичавшие» фрагменты геномов сложных организмов (см.: Данные сравнительной геномики проливают свет на происхождение ретровирусов). К этой же группе явлений относятся и плазмиды (см.: Plasmid). Как вирусы, так и плазмиды часто вступают в симбиоз со своими хозяевами, становятся безвредными или начинают приносить пользу, но только если это выгодно им самим, улучшает их шансы на успешное размножение. В принципе вирусу — при прочих равных — только лучше, если зараженный им организм будет жить долго и счастливо. Вся проблема в оговорке «при прочих равных». Если долгую жизнь хозяина можно купить только ценой снижения эффективности распространения вируса, то вирус на это не пойдет (то есть отбор такую мутацию не поддержит).

Теория также предсказывает, что взаимопомощь и альтруизм должны гораздо чаще встречаться между близкими родственниками, чем между неродственными представителями одного и того же вида. Природа буквально переполнена живыми подтверждениями этого предсказания (многочисленные примеры подробно разобраны в уже неоднократно цитировавшемся обзоре «Эволюция кооперации и альтруизма«).


Почему среди перепончатокрылых так распространен альтруизм? Один из ярких примеров действенности эволюционных моделей — это объяснение, данное Уильямом Гамильтоном тому удивительному факту, что из всех животных почему-то только у перепончатокрылых насекомых (муравьев, пчел, ос, шмелей) много раз независимо возникала эусоциальность (eusociality) — общественный образ жизни, основанный на полном отказе большинства членов группы от размножения.

Почему именно перепончатокрылые обладают повышенной склонностью к отказу от собственного размножения ради воспитания сестер? Разгадка кроется в особенностях наследования пола в этом отряде насекомых. У перепончатокрылых самки имеют двойной набор хромосом и развиваются из оплодотворенных яиц. Самцы гаплоидны (имеют одинарный набор хромосом) и развиваются из неоплодотворенных яиц. Из-за этого складывается парадоксальная ситуация: сестры оказываются более близкими родственницами, чем мать и дочь. У большинства животных степень родства между сестрами и между матерями и дочерьми одинакова (50 % общих генов). У перепончатокрылых родные сестры имеют 75 % общих генов, потому что каждая сестра получает от отца не случайно выбранную половину его хромосом, а весь геном полностью. Мать и дочь у перепончатокрылых имеют, как и у других животных, лишь 50 % общих генов. Вот и получается, что для эффективной передачи своих генов следующим поколениям самкам перепончатокрылых, при прочих равных, выгоднее заставлять свою мать рожать новых сестер и помогать ей их выращивать, чем обзаводиться собственным потомством.

Многие факты убедительно свидетельствуют о том, что альтруизм перепончатокрылых целиком и полностью основан на «генетическом эгоизме» (см.: Склонность к альтруизму сильнее у тех, кому нечего терять; Альтруизм общественных насекомых поддерживается полицейскими методами.

Эволюционная теория утверждает, что «генетический альтруизм» невозможен в принципе, по определению. Иными словами, естественный отбор не может закрепить мутацию, снижающую эффективность распространения мутировавшего аллеля по сравнению с его конкурентами — аллелями того же гена, не имеющими этой мутации. Это невозможно даже в том случае, если мутация выгодна для популяции или вида в целом. Аллель, который попытается вести себя «альтруистично» по отношению к другим аллелям того же гена, будет автоматически «отбракован» естественным отбором. С другой стороны, те виды, в которых эгоистическая эволюция аллелей зайдет слишком далеко, с большой вероятностью просто вымрут. Поэтому в биоте постепенно накапливаются такие виды, у которых по тем или иным причинам интересы эгоистичных генов не слишком сильно расходятся с интересами вида как целого. Но отбор внутри популяции, отбор на уровне особей, работает гораздо быстрее и эффективнее, чем отбор на уровне видов. Любая адаптация должна сначала сформироваться на уровне популяции, и для этого соответствующие аллели должны «победить» своих конкурентов — альтернативные аллели тех же генов. Иначе адаптация просто не закрепится, не станет нормой для данного вида. И только уже закрепившиеся адаптации попадают в сферу внимания «межвидового отбора» (избирательного вымирания) — процесса гораздо более медленного, и потому обладающего гораздо меньшей «созидательной силой».

Поэтому теория эволюции предсказывает, что: (1) в большинстве случаев адаптации должны быть полезны одновременно и для генов, которые их кодируют, и для особей, и для вида в целом, и даже, как правило, для всей экосистемы; (2) довольно часто могут встречаться ситуации, когда адаптации выгодны для генов, которые их кодируют, но вредны для вида и (или) для экосистемы; (3) обратные ситуации, когда адаптация полезна для вида, но вредна для распространения аллелей, «кодирующих» данную адаптацию, должны встречаться очень редко или не встречаться вовсе.

А что «предсказывает» антиэволюционизм? Он, как обычно, не предсказывает вообще ничего до тех пор, пока не будут хоть как-то конкретизированы представления о намерениях «разумного дизайнера». Если исходить из предположения, что «дизайнер» имел в виду создание хорошей, устойчиво функционирующей биосферы, то он должен был бы проектировать в первую очередь адаптации, выгодные биосфере как целому, затем отдельным экосистемам, затем, возможно видам и популяциям. Совершенно непонятно, зачем бы ему создавать адаптации, выгодные «эгоистичному гену» или «эгоистичной особи» и вредные для популяции, вида или экосистемы. Таким образом, идея «благонамеренного разумного дизайнера» дает отчасти такие же, а отчасти иные предсказания, чем теория естественного отбора. Предсказание (1) в обоих случаях совпадает, здесь мы не можем различить научную и антиэволюционистскую модели по их следствиям. Однако в предсказаниях (2) и (3) появляются очевидные различия. Как обычно, факты явно на стороне научной модели. Рассмотрим несколько характерных примеров.


Почему соотношение полов почти всегда 1:1? У подавляющего большинства раздельнополых животных поддерживается соотношение полов, очень близкое к 1:1. Это вполне рационально для моногамных видов, у которых образуются устойчивые брачные пары и самцы участвуют в заботе о потомстве вместе с самками. Однако моногамия — весьма редкое явление в животном мире. Гораздо больше существует видов, у которых о потомстве заботятся только самки, а роль самца ограничивается спариванием. Например, самцы павлинов тратят кучу энергии на отращивание своих прекрасных хвостов, едят пищу, которая пригодилась бы самкам и птенцам, короче говоря, только зря топчут землю и занимают жизненное пространство. Животноводам прекрасно известно, что на большое стадо коров вполне достаточно одного быка, всех остальных самцов можно смело пускать на мясо. Никакого вырождения породы от этого не происходит — скорее наоборот. В природе у стадных копытных самцы могут быть полезны для коллективной обороны стада от хищников, но гораздо чаще самцы не делают и этого. Даже если рассмотреть виды, у которых от самцов есть какая-то польза, кроме производства спермы, все равно нет абсолютно никаких оснований полагать, что при любом образе жизни, способе питания, экологической обстановке и т. п. соотношение полов 1:1 является оптимальным для любого вида животных. Если бы соотношение полов определялось интересами вида, мы бы наверняка наблюдали разное соотношение полов у разных видов. Однако мы за редчайшими исключениями везде наблюдаем одно и то же соотношение 1:1 — у моногамных и полигамных видов, у заботящихся о потомстве и у тех, кто бросает потомство на произвол судьбы, у хищников и их жертв, у тех, кто организует коллективную оборону от хищников, и тех, кто этого не делает, и т. д. Это совершенно непохоже на разумный дизайн и необъяснимо с позиций пользы для вида или биосферы. Эволюционная теория, напротив, дает четкое и красивое объяснение этому феномену. Дело в том, что равное соотношение полов является в подавляющем большинстве случаев единственной эволюционно стабильной стратегией (Evolutionarily stable strategy). Это значит, что только при таком соотношении полов никакая мутация, меняющая эта соотношение, не окажется выгодной для ее носителя. Рассмотрим воображаемую ситуацию, когда у некого вида самки рожают не 50 % детенышей мужского пола, а, скажем, только 20 %. Соответственно, в популяции на каждого самца будет приходиться 4 самки. Допустим, что это соотношение является оптимальным с точки зрения «интересов вида». Но такая ситуация эволюционно нестабильна, и вот почему. В нашей воображаемой популяции хоть самцов и меньше, чем самок, каждый детеныш все равно имеет только одну мать и только одного отца. Допустим, популяция состоит из 1000 особей, из них 200 самцов и 800 самок, и каждый год в популяции рождается 1000 детенышей. Тогда получается, что каждая самка оставит в среднем 1000/800=1.25 детенышей, а каждый самец — 1000/200=5 детенышей. Самцы размножаются в 4 раза эффективнее! Иными словами, в такой популяции быть самцом в 4 раза выгоднее, чем самкой. Теперь посмотрим, что произойдет, если в популяции появится мутантный аллель, носительницы которого рожают больше детенышей мужского пола, чем остальные самки — например, не по одному сыну на каждые четыре дочери, а по одному сыну на две дочери. Очевидно, что самка, несущая этот аллель, оставит больше внуков, чем прочие самки, и, следовательно, мутантный аллель начнет распространяться в популяции. Вскоре он неизбежно вытеснит конкурирующий (старый, «немутантный») аллель, заставляющий самок рожать детей в соотношении 1:4. В итоге соотношение полов в популяции изменится: теперь самцов будет не вчетверо, а только вдвое меньше, чем самок. Нетрудно увидеть, что подобные мутации будут до тех пор менять соотношение полов, пока оно не станет равным 1:1. Только при таком соотношении никакая новая мутация, меняющая число рождаемых мальчиков и девочек, уже не станет полезной для самки и не будет поддержана отбором.

Итак, в популяции установится соотношение полов 1:1, и никого не волнует, что вид в целом от этого только проиграет. Вид может в конце концов даже вымереть — что ж, тем хуже для него. «Межвидовой отбор» слишком медлителен и слаб, чтобы воспрепятствовать действию отбора на уровне аллелей в популяции. На самом деле виды не вымирают из-за неоптимального соотношения полов прежде всего потому, что это их общая проблема — они все в таком положении. Соотношение полов 1:1 — это почти неизбежный побочный эффект раздельнополости, следствие конкуренции между эгоистичными генами (особями), не имеющий отношения к благу вида или биосферы.

Упомянутые выше «редкие исключения» из общего правила только подтверждают его. Например, у некоторых насекомых (бабочек, мух, жуков) доля самцов в популяции может быть резко снижена из-за деятельности весьма любопытной паразитической бактерии вольбахии. Вольбахия живет внутри клеток насекомого-хозяина и не может передаваться горизонтально, т. е. заражать других насекомых. Вместо этого она передается вертикально, то есть наследуется, причем только по материнской линии. Она проникает из материнского организма в яйцеклетки, и таким образом передается потомству зараженной самки. В сперматозоид бактерия проникнуть не может — он слишком мал, и поэтому бактерии, живущие в самце, обречены погибнуть вместе с ним. С точки зрения бактерии, хозяева-самцы — это тупик, западня. Поэтому «эгоистичные интересы» вольбахии состоят в том, чтобы в популяции хозяев стало побольше самок и поменьше самцов. Вольбахия «научилась» достигать этой цели, избирательно убивая эмбрионы мужского пола. В результате в некоторых зараженных популяциях насекомых на сотню самок может приходиться всего 1–2 самца. Как ни странно, такие популяции, судя по всему, чувствуют себя отлично и вовсе не собираются вымирать. Некоторые эксперты предполагают, что эти популяции на самом деле выигрывают от того, что вольбахия помогает им поддерживать оптимальное соотношение полов. Сами насекомые не могут этого добиться из-за конфликта интересов своих «эгоистичных генов», но бактерия приходит на помощь (см. наш обзор: Бактерия вольбахия — повелитель мух).


Другие примеры адаптаций, бесполезных либо вредных для вида, но полезных для эгоистичного гена (или эгоистичной особи). Почему деревья такие высокие? Они тянутся к свету, и высокий рост позволяет им не оказаться затененными другими деревьями. Если бы деревья могли договориться между собой, они бы, возможно, ввели закон: не расти выше стольких-то метров. И им не пришлось бы тратить непомерное количество ресурсов на производство древесины. Но деревья не могут договориться, и поэтому любая мутация, позволяющая дереву вырасти чуть выше других, поддерживается отбором (потому что дерево, приподнявшееся над лесным пологом, получит больше света, произведет больше семян и оставит больше потомства). В итоге новая мутация распространится, и все деревья станут чуть выше. Эта бессмысленная (с точки зрения «блага вида») гонка продолжается до тех пор, пока увеличение роста не наткнется на какую-либо эволюционную преграду, так что дальнейший рост будет уже не улучшать а ухудшать шансы дерева на успешное размножение (например, возрастет вероятность быть поваленным ураганом).

Почему самцы так редко помогают самкам заботиться о потомстве? Если уж соотношение полов должно быть равным, и в популяции поэтому много «лишних» самцов, почему бы их не привлечь к делу? Зачем им без толку слоняться и только тратить на свое бесполезное для вида существование ценные пищевые ресурсы? Для эволюционной теории тут нет никакого парадокса: самцам часто бывает выгоднее не тратить силы и время на уход за детенышами, а заниматься поиском и соблазнением новых самок (а для этого, между прочим, полезно иметь много сил, выглядеть здоровым, хорошо питаться и поменьше работать). В первом случае самец только повышает шансы на выживание небольшого числа детенышей, во втором — у него появляется возможность произвести этих детенышей в десятки раз больше. Конечно, в каждой конкретной ситуации выгодность той или иной стратегии — заботливого отца или «мачо» — будет зависеть от конкретных обстоятельств (например, от того, насколько сильно отцовская забота может снизить смертность детенышей). Характерно, что у некоторых животных «эволюционно стабильным состоянием» оказывается одновременное существование двух типов самцов: заботливых отцов и бродячих бездельников-совратителей. Вторые, по сути, паразитируют на альтруизме первых (см.: Бойцы и проныры имеют равные шансы на успех в личной жизни; Владение земельной собственностью снижает плодовитость).

К адаптациям, выгодным «эгоистичному гену» или «эгоистичной особи», но бесполезным или вредным для вида в целом, относится большинство адаптаций, связанных с «эволюционным конфликтом полов», и значительная часть адаптаций, связанных с «эволюционными гонками вооружений» (см. раздел «Этические и эстетические аргументы«). Несомненно вреден для вида (но, к сожалению, полезен для эгоистичных самцов) инфантицид — убийство самцами чужих детенышей, о чем тоже рассказано в разделе «Этические и эстетические аргументы«. Ведь при этом убиваются не наименее приспособленные, не больные и не ущербные, а нормальные детеныши, вся «вина» которых заключается только в том, что они не родные дети своему «отчиму».

Выше мы рассмотрели пример, связанный со взаимопомощью сперматозоидов. При этом мы оставили в стороне один интересный вопрос: зачем у моногамного вида, у которого нет полиандрии и, соответственно, нет конкуренции между сперматозоидами разных самцов, сперматозоиды все равно объединяются в группы? По-видимому, потому, что сперматозоид-мутант, который не захочет ни с кем объединяться, просто-напросто проиграет гонку другим сперматозоидам того же самого самца. В данном случае налицо адаптация, не нужная ни виду в целом, ни даже отдельным самцам. Она выгодна только «эгоистичному сперматозоиду». Опять-таки, это совсем непохоже на «разумный дизайн», зато очень похоже на результат действия естественного отбора.

* * *

Существуют и другие группы фактов, демонстрирующих явное превосходство эволюционной теории над идеей «разумного дизайна» как по предсказательной, так и по объяснительной силе. Возможно, в будущем мы добавим в эту публикацию разделы, посвященные побочным эффектам эволюции, компромиссам (trade-offs) и другим явлениям, явно выдающим почерк естественного отбора, а вовсе не «разумного дизайна».


Оглавление

  • Часть I. Вводная часть
  •   Вступительное слово
  •   1. Существуют ли среди ученых разногласия по поводу реальности биологической эволюции?
  •   2. Чем гипотезы и теории отличаются от доказанных фактов
  •   3. Общие замечания
  •   4. Возможность появления новых, полезных для организма признаков посредством случайных мутаций подтверждена многочисленными фактами
  •   5. Изменения видов при доместикации (От искусственного отбора к естественному)
  • Часть II. Группы доказательств
  •   1. Наблюдаемая эволюция
  •     Наблюдаемые мутации как основа эволюционных новшеств
  •     Долгосрочный эволюционный эксперимент
  •     Развитие устойчивости к антибиотикам и пестицидам
  •     Примеры видообразования
  •     Яблонные мухи
  •     Другие хорошо документированные случаи симпатрического видообразования в природе
  •     Опыты по искусственному видообразованию (формирование репродуктивной изоляции)
  •     Промежуточные этапы видообразования
  •     Белый медведь
  •   2. Эволюционное дерево
  •   3. Палеонтологические доказательства
  •     Ископаемая летопись
  •     Биостратиграфия
  •     Переходные формы
  •     Превращение динозавров в птиц («орнитизация динозавров-теропод»)
  •     Другие переходные формы между крупными таксонами
  •     Эволюция человека
  •     Эволюция лошади
  •     «Микро» и «макро»
  •   4. Морфологические доказательства
  •     Введение
  •     Гомологичные органы
  •     Пятипалая конечность
  •     Части ротового аппарата насекомых
  •     Рудименты
  •     Атавизмы
  •     Несовершенство строения организмов
  •     Эволюция глаза
  •     Пост-транскрипционная регуляция работы генов
  •   5. Эмбриологические доказательства
  •     Свидетельства эволюции в индивидуальном развитии организмов
  •     Эво-дево: следы макроэволюции
  •     Монстры и макроэволюция
  •   6. Молекулярно-генетические и биохимические доказательства
  •     Открытия молекулярной генетики блестяще подтвердили факт эволюции
  •     Пример сравнения нуклеотидных и аминокислотных последовательностей человека и шимпанзе
  •     Биохимическое единство жизни
  •     2-я хромосома человека
  •     Эндогенные ретровирусы
  •     Псевдогены
  •   7. Биогеографические доказательства
  •     Географическое распространение животных и растений соответствует их эволюционной истории
  •     Островная биогеография
  •     Заселение изолированных территорий
  •     Дарвиновы вьюрки
  •     Параллельная эволюция на разобщенных массивах суши
  •     Распространение ископаемых видов согласуется с эволюционным деревом и палеогеографическими реконструкциями
  • Часть III. Дополнительные материалы
  •   8. Полезная литература и ссылки
  •     Доказательства эволюции и опровержение «доводов» антиэволюционистов
  •     Маст рид по эволюции
  •     Учебники и т. п
  •   9. Этические и эстетические аргументы против креационизма
  •     Введение
  •     Необычайная любовь к жукам
  •     «Как Бог черепаху»
  •     Утонченный садизм
  •     Конфликт полов
  •   10. Ответы на некоторые типичные «доводы» антиэволюционистов
  •     Почему «кембрийский взрыв» не является аргументом против эволюции
  •     Эволюция, случайность, энтропия, или Как Дарвин и Клаузиус оказались правыми одновременно)
  •     Проставляем даты на геологической летописи, или Как физики геологам помогают
  •     Почему остатки белковых молекул в костях динозавров не являются доказательством молодости Земли
  •     «Несократимая сложность» и бактериальный жгутик
  •     «Эволюция — ложь, потому что многие великие ученые были верующими»
  •     Очень краткие ответы на наиболее часто встречающиеся вопросы
  •   11. Некоторые более сложные доказательства
  •     Эволюционная теория изо дня в день подтверждается научно-исследовательской практикой
  •     Cui prodest?